Details of Host Protein

Host Protein General Information (ID: PT0001)
Protein Name	Mitochondrial 10kDa heat shock protein (HSPE1)	Gene Name	HSPE1
Host Species	Homo sapiens	Uniprot Entry Name	CH10_HUMAN
Protein Families	GroES chaperonin family
Subcellular Location	Mitochondrion matrix
External Link
	NCBI Gene ID	3336
	Uniprot ID	P61604
	Ensembl ID	ENSG00000115541
	HGNC ID	HGNC:5269
Function in Host	Co-chaperonin implicated in mitochondrial protein import andmacromolecular assembly. Together with Hsp60, facilitates the correctfolding of imported proteins. May also prevent misfolding and promotethe refolding and proper assembly of unfolded polypeptides generatedunder stress conditions in the mitochondrial matrix. The functional units of thesechaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric ringsof the co-chaperonin Hsp10. This leads to sequestration of thesubstrate protein in the inner cavity of Hsp60 where, for a certainperiod of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in thedissociation of the chaperonin rings and the release of ADP and thefolded substrate protein. [1-4] Click to Show/Hide
3D Structure	PDB ID: 4PJ1 FASTA Download 2D PNG Download PDB File Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[5]
Strains Name	hCoV-19/IPBCAMS-YL01/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	3'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Unlikely to be direct binder
Infection Cells	Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 )
Cell Originated Tissue	Liver
Infection Time	30 h
Interaction Score	MIST = 0.695892628
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Click to Show/Hide

References
1	Crystal structure of the human mitochondrial chaperonin symmetrical football complex. Proc Natl Acad Sci USA. 2015 May 12;112(19):6044-9.
2	The effect of nucleotides and mitochondrial chaperonin 10 on the structure and chaperone activity of mitochondrial chaperonin 60. Eur J Biochem. 2001 Jun;268(12):3465-72.
3	The purification of early-pregnancy factor to homogeneity from human platelets and identification as chaperonin 10. Eur J Biochem. 1994 Jun 1;222(2):551-60.
4	Mammalian mitochondrial chaperonin 60 functions as a single toroidal ring. J Biol Chem. 1992 Jan 15;267(2):695-8.
5	Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.