Details of Host Protein

Host Protein General Information (ID: PT0233)
Protein Name	Zinc finger protein 207 (hBuGZ)	Gene Name	ZNF207
Host Species	Homo sapiens	Uniprot Entry Name	ZN207_HUMAN
Subcellular Location	Nucleus Chromosome; centromere; kinetochore Cytoplasm
External Link
	NCBI Gene ID	7756
	Uniprot ID	O43670
	Ensembl ID	ENSG00000010244
	HGNC ID	HGNC:12998
Function in Host	Kinetochore- and microtubule-binding protein that plays a keyrole in spindle assembly. ZNF207/BuGZ is mainly composed of disordered low-complexity regions and undergoes phase transition or coacervation toform temperature-dependent liquid droplets. Coacervation promotesmicrotubule bundling and concentrates tubulin, promoting microtubulepolymerization and assembly of spindle and spindle matrix byconcentrating its building blocks. Also acts as aregulator of mitotic chromosome alignment by mediating the stabilityand kinetochore loading of BUB3. Mechanisms by which BUB3 is protected are unclear: according to a firstreport, ZNF207/BuGZ may act by blocking ubiquitination and proteasomaldegradation of BUB3. According to another report, thestabilization is independent of the proteasome. [1-3] Click to Show/Hide
3D Structure	AlphaFold ID: O43670 2D PNG Download mmCIF File Download PDB File Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 5'-UTR (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[4]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) (CVCL_0336;CVCL_0609 )
Cell Originated Tissue	Liver; Lung
Interaction Score	P-value < 0.05
Method Description	RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY Click to Show/Hide

References
1	Phase transition of spindle-associated protein regulate spindle apparatus assembly. Cell. 2015 Sep 24;163(1):108-22.
2	BuGZ is required for Bub3 stability, Bub1 kinetochore function, and chromosome alignment. Dev Cell. 2014 Feb 10;28(3):282-94.
3	A microtubule-associated zinc finger protein, BuGZ, regulates mitotic chromosome alignment by ensuring Bub3 stability and kinetochore targeting. Dev Cell. 2014 Feb 10;28(3):268-81.
4	Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.