Details of Host Protein

 Host Protein General Information (ID: PT0249)
  Protein Name
S-nitrosoglutathione reductase (CBR1)
  Gene Name
CBR1
  Host Species
Homo sapiens
  Uniprot Entry Name
CBR1_HUMAN
  Protein Families
Short-chain dehydrogenases/reductases(SDR) family
  EC Number
1.1.1.184; 1.1.1.196; 1.1.1.197; 1.1.1.189
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
873
Uniprot ID
P16152
Ensembl ID
ENSG00000159228
HGNC ID
HGNC:1548
  Function in Host
NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compoundsincluding quinones, prostaglandins, menadione, plus variousxenobiotics. Catalyzes the reduction of the antitumor anthracyclinesdoxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinoland daunorubicinol. Canconvert prostaglandin E to prostaglandin F2-alpha. Canbind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. In addition, participates in theglucocorticoid metabolism by catalyzing the NADPH-dependentcortisol/corticosterone into 20beta-dihydrocortisol (20b-DHF) or20beta-corticosterone (20b-DHB), which are weak agonists of NR3C1 andNR3C2 in adipose tissue. [1-6]
    Click to Show/Hide
  Related KEGG Pathway
Folate biosynthesis hsa00790            Pathway Map 
Metabolism of xenobiotics by cytochrome P450 hsa00980            Pathway Map 
Chemical carcinogenesis - DNA adducts hsa05204            Pathway Map 
Chemical carcinogenesis - reactive oxygen species hsa05208            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Arachidonic acid metabolism hsa00590            Pathway Map 
  3D Structure
PDB ID: 1WMA 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/France/IDF-220-95/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [7]
              Strains Name
hCoV-19/France/IDF-220-95/2020
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Direct interaction
              Infection Cells HEK293 Cells (Human embryonic kidney cell)  (CVCL_0045 )
              Cell Originated Tissue Kidney
              Infection Time 48 h
              Interaction Score SAINT score ≥ 0.79
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S151 [8]
  PNG Download  
Picture Not Found

Potential Drug(s) that Targets This Protein
Drug Name DrunkBank ID Pubchem ID TTD ID REF
Triclosan DB08604  5564  D00CSQ  [9]

Protein Sequence Information
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
    Click to Show/Hide

References
1 Purification and properties of an NADPH-dependent carbonyl reductase from human brain Relationship to prostaglandin 9-ketoreductase and xenobiotic ketone reductase. J Biol Chem. 1981 Feb 10;256(3):1206-13.
2 Inhibition of polymorphic human carbonyl reductase 1 (CBR1) by the cardioprotectant flavonoid 7-monohydroxyethyl rutoside (monoHER). Pharm Res. 2008 Jul;25(7):1730-4.
3 Human carbonyl reductase 1 is an S-nitrosoglutathione reductase. J Biol Chem. 2008 Dec 19;283(51):35756-62.
4 Glutathione traps formaldehyde by formation of a bicyclo[4.4.1]undecane adduct. Org Biomol Chem. 2007 Oct 21;5(20):3363-7.
5 A functional genetic polymorphism on human carbonyl reductase 1 (CBR1 V88I) impacts on catalytic activity and NADPH binding affinity. Drug Metab Dispos. 2007 Jun;35(6):973-80.
6 An unbiased cell morphology-based screen for new, biologically active small molecules. PLoS Biol. 2005 May;3(5):e128.
7 Characterization and functional interrogation of the SARS-CoV-2 RNA interactome. Cell Rep. 2022 Apr 26;39(4):110744.
8 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
9 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.