Details of Host Protein
Host Protein General Information (ID: PT0249) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
S-nitrosoglutathione reductase (CBR1)
|
Gene Name |
CBR1
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
CBR1_HUMAN
|
||||||
Protein Families |
Short-chain dehydrogenases/reductases(SDR) family
|
||||||||
EC Number |
1.1.1.184; 1.1.1.196; 1.1.1.197; 1.1.1.189
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compoundsincluding quinones, prostaglandins, menadione, plus variousxenobiotics. Catalyzes the reduction of the antitumor anthracyclinesdoxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinoland daunorubicinol. Canconvert prostaglandin E to prostaglandin F2-alpha. Canbind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. In addition, participates in theglucocorticoid metabolism by catalyzing the NADPH-dependentcortisol/corticosterone into 20beta-dihydrocortisol (20b-DHF) or20beta-corticosterone (20b-DHB), which are weak agonists of NR3C1 andNR3C2 in adipose tissue.
[1-6]
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Folate biosynthesis | hsa00790 |
Pathway Map ![]() |
|||||||
Metabolism of xenobiotics by cytochrome P450 | hsa00980 |
Pathway Map ![]() |
|||||||
Chemical carcinogenesis - DNA adducts | hsa05204 |
Pathway Map ![]() |
|||||||
Chemical carcinogenesis - reactive oxygen species | hsa05208 |
Pathway Map ![]() |
|||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Arachidonic acid metabolism | hsa00590 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: Not Specified Virus Region (hCoV-19/France/IDF-220-95/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[7] | |||||||
Strains Name |
hCoV-19/France/IDF-220-95/2020
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Interaction Type | Direct interaction | ||||||||
Infection Cells | HEK293 Cells (Human embryonic kidney cell) (CVCL_0045 ) | ||||||||
Cell Originated Tissue | Kidney | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | SAINT score ≥ 0.79 | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
S151
[8] |
![]() |
Potential Drug(s) that Targets This Protein | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Triclosan | DB08604 | 5564 | D00CSQ | [9] |
Protein Sequence Information |
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Click to Show/Hide
|
---|