Details of Host Protein

 Host Protein General Information (ID: PT0253)
  Protein Name
Cathepsin D (CTSD)
  Gene Name
CTSD
  Host Species
Homo sapiens
  Uniprot Entry Name
CATD_HUMAN
  Protein Families
Peptidase A1 family
  EC Number
3.4.23.5
  Subcellular Location
Lysosome
  External Link
NCBI Gene ID
1509
Uniprot ID
P07339
Ensembl ID
ENSG00000117984
HGNC ID
HGNC:2529
  Function in Host
Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation byADAM30 which leads to APP degradation. Involved inthe pathogenesis of several diseases such as breast cancer and possiblyAlzheimer disease. [1]
    Click to Show/Hide
  Related KEGG Pathway
Tuberculosis hsa05152            Pathway Map 
Sphingolipid signaling pathway hsa04071            Pathway Map 
Autophagy - animal hsa04140            Pathway Map 
Lysosome hsa04142            Pathway Map 
Apoptosis hsa04210            Pathway Map 
Diabetic cardiomyopathy hsa05415            Pathway Map 
Estrogen signaling pathway hsa04915            Pathway Map 
  3D Structure
PDB ID: 1LYA 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [2]
Infected TissueColon Infection Time48 h
Infected CellCaco-2 cells (Human colorectal adenocarcinoma cell) Cellosaurus IDCVCL_0025 
Method DescriptionTo detect the role of host protein CTSD in viral infection, CTSD protein knockout Caco-2 cells were infected with SARS-COV-2 for 48 h , and the effects on infection was detected through qPCR.
ResultsIt is reported that Knockdown of CTSD leads to the Increase the vRNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Unlikely to be direct binder
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.880111998
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Potential Drug(s) that Targets This Protein
Drug Name DrunkBank ID Pubchem ID TTD ID REF
Amprenavir DB00701  65016  D0A0OO  [3]
Bortezomib DB00188  387447  D0SH3I  [2]
Chlorambucil DB00291  2708  D0V8QT  [3]
teicoplanin DB06149  133065662  D0K6MW  [4]
Tipranavir DB00932  54682461  D0EV6T  [2]
Triparanol . 72430  D0G5ZE  [4]
Triparanol . 11582982  D00ZUU  [4]
Triparanol . . D0JO0I  [4]

Protein Sequence Information
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
    Click to Show/Hide

References
1 ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer s Disease. EBioMedicine. 2016 Jul;9:278-292.
2 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
3 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
4 Cellular host factors for SARS-CoV-2 infection. Nat Microbiol. 2021 Oct;6(10):1219-1232.