Details of Host Protein

 Host Protein General Information (ID: PT0329)
  Protein Name
Dermcidin (DCD)
  Gene Name
DCD
  Host Species
Homo sapiens
  Uniprot Entry Name
DCD_HUMAN
  EC Number
3.4.-.-
  Subcellular Location
Secreted
  External Link
NCBI Gene ID
117159
Uniprot ID
P81605
Ensembl ID
ENSG00000161634
HGNC ID
HGNC:14669
  Function in Host
.Found in sweat, has an antimicrobial activity duringearly bacterial colonization. Thesecreted peptide assembles into homohexameric complexes that canassociate with and also insert into pathogen membranes. Once inserted in bacteria membranes forms anionchannels probably altering the transmembrane potential essential forbacterial survival. Highly effective against E. coli, E. faecalis, S. aureus and C. albicans. Optimal pH andsalt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side ofArg and, to a lesser extent, Lys residues.
    Click to Show/Hide
  3D Structure
PDB ID: 2KSG 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [1]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein DCD in viral infection, DCD protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of DCD increases SARS-CoV-2 RNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Unlikely to be direct binder
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.655835301
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

Potential Drug(s) that Targets This Protein
Drug Name DrunkBank ID Pubchem ID TTD ID REF
Zinc DB01593  23994  . [3]
Zinc acetate DB14487  11192  D0Z4NI  [3]
Zinc chloride DB14533  5727  D05ELV  [3]
Zinc sulfate DB09322  24424  D07CEI  [3]

Protein Sequence Information
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
    Click to Show/Hide

References
1 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
2 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
3 Interactomes of SARS-CoV-2 and human coronaviruses reveal host factors potentially affecting pathogenesis. EMBO J. 2021 Sep 1;40(17):e107776.