Details of Host Protein
| Host Protein General Information (ID: PT0552) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
Histone H4 (HNRNPCL1)
|
Gene Name |
H4C1
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
H4_HUMAN
|
||||||
| Protein Families |
Histone H4 family
|
||||||||
| Subcellular Location |
Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
Core component of nucleosome. Nucleosomes wrap and compactDNA into chromatin, limiting DNA accessibility to the cellularmachineries which require DNA as a template. Histones thereby play acentral role in transcription regulation, DNA repair, DNA replicationand chromosomal stability. DNA accessibility is regulated via a complexset of post-translational modifications of histones, also calledhistone code, and nucleosome remodeling.
Click to Show/Hide
|
||||||||
| Related KEGG Pathway | |||||||||
| Systemic lupus erythematosus | hsa05322 |
Pathway Map
|
|||||||
| Neutrophil extracellular trap formation | hsa04613 |
Pathway Map
|
|||||||
| Viral carcinogenesis | hsa05203 |
Pathway Map
|
|||||||
| Alcoholism | hsa05034 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[1] | |||||||
| Strains Name |
hCoV-19/IPBCAMS-YL01/2020
|
||||||||
| Strains Family |
Beta (B.1.351)
|
||||||||
| RNA Binding Region |
3'-UTR
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Interaction Type | Unlikely to be direct binder | ||||||||
| Infection Cells | Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 30 h | ||||||||
| Interaction Score | MIST = 0.668169604 | ||||||||
| Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
S48
[2] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
S48
[3] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Click to Show/Hide
|
|---|





