Details of Host Protein

 Host Protein General Information (ID: PT0581)
  Protein Name
Isocitrate dehydrogenase [NADP] (IDH2)
  Gene Name
IDH2
  Host Species
Homo sapiens
  Uniprot Entry Name
IDHP_HUMAN
  Protein Families
Isocitrate and isopropylmalate dehydrogenases family
  EC Number
1.1.1.42
  Subcellular Location
Mitochondrion
  External Link
NCBI Gene ID
3418
Uniprot ID
P48735
Ensembl ID
ENSG00000182054
HGNC ID
HGNC:5383
  Function in Host
Plays a role in intermediary metabolism and energy production. It may tightly associate orinteract with the pyruvate dehydrogenase complex.
    Click to Show/Hide
  Related KEGG Pathway
Central carbon metabolism in cancer hsa05230            Pathway Map 
Glutathione metabolism hsa00480            Pathway Map 
Peroxisome hsa04146            Pathway Map 
Citrate cycle (TCA cycle) hsa00020            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Carbon metabolism hsa01200            Pathway Map 
2-Oxocarboxylic acid metabolism hsa01210            Pathway Map 
Biosynthesis of amino acids hsa01230            Pathway Map 
  3D Structure
PDB ID: 4JA8 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Pro-viral [1]
Infected TissueColon Infection Time48 h
Infected CellCaco-2 cells (Human colorectal adenocarcinoma cells) Cellosaurus IDCVCL_0025 
Method DescriptionTo detect the role of host protein IDH2 in viral infection, IDH2 protein knockout Caco-2 cells were infected with SARS-COV-2 for 48 h , and the effects on infection was detected through qPCR.
ResultsIt is reported that Knockdown of IDH2 leads to the reduced the vRNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [1]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Unlikely to be direct binder
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.665104336
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Potential Drug(s) that Targets This Protein
Drug Name DrunkBank ID Pubchem ID TTD ID REF
Enasidenib DB13874  89683805  D0WH4P  [1]

Protein Sequence Information
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
    Click to Show/Hide

References
1 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.