Details of Host Protein

 Host Protein General Information (ID: PT0770)
  Protein Name
Polyubiquitin-C (UBC)
  Gene Name
UBC
  Host Species
Homo sapiens
  Uniprot Entry Name
UBC_HUMAN
  Protein Families
Ubiquitin family
  Subcellular Location
Cytoplasm and cytosol; nucleus
  External Link
NCBI Gene ID
7316
Uniprot ID
P0CG48
Ensembl ID
ENSG00000150991
HGNC ID
HGNC:12468
  Function in Host
Exists either covalently attached to anotherprotein, or free (unanchored). When covalently bound, it is conjugatedto target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of theubiquitin (polyubiquitin chains) or a linear polymer linked via theinitiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have differentfunctions depending on the Lys residue of the ubiquitin that is linked:Lys-6-linked may be involved in DNA repair; Lys-11-linked is involvedin ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stressresponse and cell cycle; Lys-33-linked is involved in kinasemodification; Lys-48-linked is involved in protein degradation via theproteasome; Lys-63-linked is involved in endocytosis, DNA-damageresponses as well as in signaling processes leading to activation ofthe transcription factor NF-kappa-B. Linear polymer chains formed viaattachment by the initiator Met lead to cell signaling. Ubiquitin isusually conjugated to Lys residues of target proteins, however, in rarecases, conjugation to Cys or Ser residues has been observed. Whenpolyubiquitin is free (unanchored-polyubiquitin), it also has distinctroles, such as in activation of protein kinases, and in signaling. [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Kaposi sarcoma-associated herpesvirus infection hsa05167            Pathway Map 
Shigellosis hsa05131            Pathway Map 
Ubiquitin mediated proteolysis hsa04120            Pathway Map 
Mitophagy - animal hsa04137            Pathway Map 
PPAR signaling pathway hsa03320            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure
PDB ID: 1C3T 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [4]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein UBC in viral infection, UBC protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of UBC increases SARS-CoV-2 RNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [5]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Unlikely to be direct binder
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.685554474
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV
    Click to Show/Hide

References
1 K29-linked ubiquitin signaling regulates proteotoxic stress response and cell cycle. Nat Chem Biol. 2021 Aug;17(8):896-905.
2 The emerging complexity of protein ubiquitination. Biochem Soc Trans. 2009 Oct;37(Pt 5):937-53.
3 Differential regulation of EGF receptor internalization and degradation by multiubiquitination within the kinase domain. Mol Cell. 2006 Mar 17;21(6):737-48.
4 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
5 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.