Details of Host Protein

 Host Protein General Information (ID: PT1135)
  Protein Name
THO complex subunit 4 (RPL23L)
  Gene Name
THOC4
  Host Species
Homo sapiens
  Uniprot Entry Name
THOC4_HUMAN
  Protein Families
ALYREF family
  Subcellular Location
Nucleus speckle Cytoplasm
  External Link
NCBI Gene ID
10189
Uniprot ID
Q86V81
Ensembl ID
ENSG00000214026
HGNC ID
HGNC:19071
  Function in Host
Export adapter involved in nuclear export of spliced andunspliced mRNA. Binds mRNA which is thought to be transferred to theNXF1-NXT1 heterodimer for export (TAP/NFX1 pathway). Component of the TREX complex whichis thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unsplicedpre-mRNA. TREX isrecruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and isrecruited in a splicing- and cap-dependent manner to a region near the5' end of the mRNA where it functions in mRNA export to the cytoplasm. TREX recruitmentoccurs via an interaction between ALYREF/THOC4 and the cap-bindingprotein NCBP1. TheTREX complex is essential for the export of Kaposi's sarcoma-associatedherpesvirus (KSHV) intronless mRNAs and infectious virus production;ALYREF/THOC4 mediates the recruitment of the TREX complex to theintronless viral mRNA. Required for TREX complexassembly and for linking DDX39B to the cap-binding complex (CBC). In conjunction with THOC5 functionsin NXF1-NXT1 mediated nuclear export of HSP70 mRNA; both proteinsenhance the RNA binding activity of NXF1 and are required for NXF1localization to the nuclear rim. Involved in thenuclear export of intronless mRNA; proposed to be recruited tointronless mRNA by ATP-bound DDX39B. Involved in transcriptionelongation and genome stability. Involved in mRNA export of C5-methylcytosine (m5C) -containing mRNAs:specifically recognizes and binds m5C mRNAs and mediates their nucleo-cytoplasmic shuttling. [1-11]
    Click to Show/Hide
  Related KEGG Pathway
Herpes simplex virus 1 infection hsa05168            Pathway Map 
Nucleocytoplasmic transport hsa03013            Pathway Map 
mRNA surveillance pathway hsa03015            Pathway Map 
Spliceosome hsa03040            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
  3D Structure
PDB ID: 3ULH 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [12]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type Potiential to be direct binder
              Interaction Binding Type Single stranded RNA binding
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.981923367
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S239 [13]
  PNG Download  
Picture Not Found
S34 [13]
  PNG Download  
Picture Not Found

Protein Sequence Information
MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS
    Click to Show/Hide

References
1 Human mRNA export machinery recruited to the 5 end of mRNA. Cell. 2006 Dec 29;127(7):1389-400.
2 Luzp4 defines a new mRNA export pathway in cancer cells. Nucleic Acids Res. 2015 Feb 27;43(4):2353-66.
3 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA. Nucleic Acids Res. 2013 Jan;41(2):1294-306.
4 TREX exposes the RNA-binding domain of Nxf1 to enable mRNA export. Nat Commun. 2012;3:1006.
5 Genome instability and transcription elongation impairment in human cells depleted of THO/TREX. PLoS Genet. 2011 Dec;7(12):e1002386.
6 Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP. Proc Natl Acad Sci USA. 2008 Apr 1;105(13):5154-9.
7 Recruitment of the human TREX complex to mRNA during splicing. Genes Dev. 2005 Jul 1;19(13):1512-7.
8 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers. Cancer Res. 2005 Apr 15;65(8):3011-6.
9 TREX is a conserved complex coupling transcription with messenger RNA export. Nature. 2002 May 16;417(6886):304-8.
10 Pre-mRNA splicing and mRNA export linked by direct interactions between UAP56 and Aly. Nature. 2001 Oct 11;413(6856):644-7.
11 Magoh, a human homolog of Drosophila mago nashi protein, is a component of the splicing-dependent exon-exon junction complex. EMBO J. 2001 Nov 15;20(22):6424-33.
12 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
13 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.