Details of Host Protein

KEGG: hsa05164 Pathway Download ×

KEGG: hsa04972 Pathway Download ×

KEGG: hsa04974 Pathway Download ×

KEGG: hsa04080 Pathway Download ×

Host Protein General Information (ID: PT1184)
Protein Name	Trypsin-3 (PRSS3)	Gene Name	PRSS3
Host Species	Homo sapiens	Uniprot Entry Name	TRY3_HUMAN
Protein Families	Peptidase S1 family
EC Number	3.4.21.4
Subcellular Location	Secreted
External Link
	NCBI Gene ID	5646
	Uniprot ID	P35030
	Ensembl ID	ENSG00000010438
	HGNC ID	HGNC:9486
Function in Host	Digestive protease that cleaves proteins preferentially afteran Arg residue and has proteolytic activity toward Kunitz-type trypsininhibitors. [1-6] Click to Show/Hide
Related KEGG Pathway
	Influenza A	hsa05164		Pathway Map
	Pancreatic secretion	hsa04972		Pathway Map
	Protein digestion and absorption	hsa04974		Pathway Map
	Neuroactive ligand-receptor interaction	hsa04080		Pathway Map
3D Structure	PDB ID: 1H4W FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Pro-viral	[7]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein PRSS3 in viral infection, PRSS3 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of PRSS3 leads to the decreased SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[8]
Strains Name	hCoV-19/IPBCAMS-YL01/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	3'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Unlikely to be direct binder
Infection Cells	Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 )
Cell Originated Tissue	Liver
Infection Time	30 h
Interaction Score	MIST = 0.638470993
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS Click to Show/Hide

References
1	An Acrobatic Substrate Metamorphosis Reveals a Requirement for Substrate Conformational Dynamics in Trypsin Proteolysis. J Biol Chem. 2016 Dec 16;291(51):26304-26319.
2	Sequence and conformational specificity in substrate recognition: several human Kunitz protease inhibitor domains are specific substrates of mesotrypsin. J Biol Chem. 2014 Nov 21;289(47):32783-97.
3	Structural basis for accelerated cleavage of bovine pancreatic trypsin inhibitor (BPTI) by human mesotrypsin. J Biol Chem. 2008 Feb 15;283(7):4115-23.
4	Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors. J Biol Chem. 2003 Dec 5;278(49):48580-9.
5	Crystal structure reveals basis for the inhibitor resistance of human brain trypsin. J Mol Biol. 2002 Feb 1;315(5):1209-18.
6	Identification and expression of the cDNA-encoding human mesotrypsin(ogen), an isoform of trypsin with inhibitor resistance. J Biol Chem. 1997 Apr 18;272(16):10573-8.
7	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
8	Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.