Details of Host Protein

 Host Protein General Information (ID: PT1200)
  Protein Name
U1 small nuclear ribonucleoprotein C (SNRPC)
  Gene Name
SNRPC
  Host Species
Homo sapiens
  Uniprot Entry Name
RU1C_HUMAN
  Protein Families
U1 small nuclear ribonucleoprotein C family
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
6631
Uniprot ID
P09234
Ensembl ID
ENSG00000124562
HGNC ID
HGNC:11157
  Function in Host
Component of the spliceosomal U1 snRNP, which is essentialfor recognition of the pre-mRNA 5' splice-site and the subsequentassembly of the spliceosome. SNRPC/U1-C is directly involved in initial5' splice-site recognition for both constitutive and regulatedalternative splicing. The interaction with the 5' splice-site seems toprecede base-pairing between the pre-mRNA and the U1 snRNA. Stimulatescommitment or early (E) complex formation by stabilizing the basepairing of the 5' end of the U1 snRNA and the 5' splice-site region. [1-4]
    Click to Show/Hide
  Related KEGG Pathway
Spliceosome hsa03040            Pathway Map 
Spliceosome hsa03040            Pathway Map 
  3D Structure
PDB ID: 2VRD 
FASTA   Download
  2D PNG Download  
PDB File Download

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Pro-viral [5]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein SNRPC in viral infection, SNRPC protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of SNRPC leads to the decreased SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network
  Network Download  

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 5'-UTR (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line)  (CVCL_0336;CVCL_0609 )
              Cell Originated Tissue Liver; Lung
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)
           RNA Region: 5'-UTR of ORF6 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
5'-UTR of ORF6
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line) Huh7 cells (human liver cell line); Calu-3 cells (human lung cancer cell line)  (CVCL_0336;CVCL_0609 )
              Cell Originated Tissue Liver; Lung
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S17 [7]
  PNG Download  
Picture Not Found

Protein Sequence Information
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
    Click to Show/Hide

References
1 Involvement of U1 small nuclear ribonucleoproteins (snRNP) in 5 splice site-U1 snRNP interaction. J Biol Chem. 1996 Sep 27;271(39):23985-91.
2 U1-specific protein C needed for efficient complex formation of U1 snRNP with a 5 splice site. Science. 1990 Jan 5;247(4938):69-72.
3 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution. Nature. 2009 Mar 26;458(7237):475-80.
4 Zinc finger-like structure in U1-specific protein C is essential for specific binding to U1 snRNP. Nucleic Acids Res. 1991 Feb 11;19(3):449-54.
5 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
6 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.
7 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.