Host Protein General Information (ID: PT0006)
  Protein Name
14-3-3 protein theta (HS1)
  Gene Name
YWHAQ
  Host Species
Homo sapiens
  Uniprot Entry Name
1433T_HUMAN
  Protein Families
14-3-3 family
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
10971
Uniprot ID
P27348
Ensembl ID
ENSG00000134308
HGNC ID
HGNC:12854
  Function in Host
Adapter protein implicated in the regulation of a largespectrum of both general and specialized signaling pathways. Binds to alarge number of partners, usually by recognition of a phosphoserine orphosphothreonine motif. Binding generally results in the modulation ofthe activity of the binding partner. Negatively regulates the kinaseactivity of PDPK1. [1]
    Click to Show/Hide
  Related KEGG Pathway
Hepatitis C hsa05160            Pathway Map 
Hepatitis B hsa05161            Pathway Map 
Viral carcinogenesis hsa05203            Pathway Map 
Cell cycle hsa04110            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
PI3K-Akt signaling pathway hsa04151            Pathway Map 
Hippo signaling pathway hsa04390            Pathway Map 
  3D Structure

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Sequence Information
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
    Click to Show/Hide

References
1 Regulation of kinase activity of 3-phosphoinositide-dependent protein kinase-1 by binding to 14-3-3. J Biol Chem. 2002 Oct 18;277(42):39360-7.
2 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.