Details of Host Protein
Host Protein General Information (ID: PT0020) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Proteasome 26S subunit ATPase 1 (P26s4)
|
Gene Name |
PSMC1
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PRS4_HUMAN
|
||||||
Protein Families |
AAA ATPase family
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Component of the 26S proteasome, a multiprotein complexinvolved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasisby removing misfolded or damaged proteins, which could impair cellularfunctions, and by removing proteins whose functions are no longerrequired. Therefore, the proteasome participates in numerous cellularprocesses, including cell cycle progression, apoptosis, or DNA damagerepair. PSMC1 belongs to the heterohexameric ring of AAA (ATPasesassociated with diverse cellular activities) proteins that unfoldsubiquitinated target proteins that are concurrently translocated into aproteolytic chamber and degraded into peptides.
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Human papillomavirus infection | hsa05165 |
Pathway Map ![]() |
|||||||
Epstein-Barr virus infection | hsa05169 |
Pathway Map ![]() |
|||||||
Viral carcinogenesis | hsa05203 |
Pathway Map ![]() |
|||||||
Proteasome | hsa03050 |
Pathway Map ![]() |
|||||||
Alzheimer disease | hsa05010 |
Pathway Map ![]() |
|||||||
Parkinson disease | hsa05012 |
Pathway Map ![]() |
|||||||
Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map ![]() |
|||||||
Huntington disease | hsa05016 |
Pathway Map ![]() |
|||||||
Spinocerebellar ataxia | hsa05017 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[1] | |||||||
Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
Strains Family |
Alpha (B.1.1.7)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
T53
[2] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
T56
[2] |
![]() |
Protein Sequence Information |
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
Click to Show/Hide
|
---|