Host Protein General Information (ID: PT0063)
  Protein Name
3-mercaptopyruvate sulfurtransferase (MST)
  Gene Name
MPST
  Host Species
Homo sapiens
  Uniprot Entry Name
THTM_HUMAN
  EC Number
2.8.1.2
  Subcellular Location
Cytoplasm Mitochondrion Cell junction; synapse; synaptosome
  External Link
NCBI Gene ID
4357
Uniprot ID
P25325
Ensembl ID
ENSG00000128309
HGNC ID
HGNC:7223
  Function in Host
Transfer of a sulfur ion to cyanide or to other thiolcompounds. Also has weak rhodanese activity. Detoxifies cyanide and isrequired for thiosulfate biosynthesis. Acts as an antioxidant. Incombination with cysteine aminotransferase (CAT), contributes to thecatabolism of cysteine and is an important producer of hydrogen sulfidein the brain, retina and vascular endothelial cells. Hydrogen sulfideH (2) S is an important synaptic modulator, signaling molecule, smoothmuscle contractor and neuroprotectant. Its production by the 3MST/CATpathway is regulated by calcium ions.
    Click to Show/Hide
  Related KEGG Pathway
Sulfur relay system hsa04122            Pathway Map 
Cysteine and methionine metabolism hsa00270            Pathway Map 
Sulfur metabolism hsa00920            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
  3D Structure

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [1]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7 cells (liver carcinoma cell)  (CVCL_0336 )
              Cell Originated Tissue Liver
              Infection Time 24h
              Interaction Score log2FC = 3.86924E+14
              Method Description RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Sequence Information
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
    Click to Show/Hide

References
1 The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.