Details of Host Protein

KEGG: hsa05171 Pathway Download ×

KEGG: hsa03010 Pathway Download ×

Host Protein General Information (ID: PT0094)
Protein Name		60S ribosomal protein L10a (RPLP2)			Gene Name		RPLP2
Host Species		Homo sapiens			Uniprot Entry Name		RLA2_HUMAN
Protein Families		Eukaryotic ribosomal protein P1/P2 family
External Link
		NCBI Gene ID			6181
		Uniprot ID			P05387
		Ensembl ID			ENSG00000177600
		HGNC ID			HGNC:10377
Function in Host		Plays an important role in the elongation step of proteinsynthesis.     Click to Show/Hide
Related KEGG Pathway
		Coronavirus disease - COVID-19			hsa05171			Pathway Map
		Ribosome			hsa03010			Pathway Map
3D Structure		PDB ID: 1S4J  FASTA   Download   2D PNG Download   PDB File Download

Host Protein - Virus RNA Network
Network Download

Full List of Virus RNA Interacting with This Protien
RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
RNA Region Details			RNA Info Click to show the detail information of this RNA binding region						[1]
Strains Name			hCoV-19/IPBCAMS-YL01/2020
Strains Family			Beta (B.1.351)
RNA Binding Region			3'-UTR
Virus Name			Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type			Potiential to be direct binder
Infection Cells			Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
Cell Originated Tissue			Liver
Infection Time			30 h
Interaction Score			MIST = 0.685523451
Method Description			comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
RNA Region Details			RNA Info Click to show the detail information of this RNA binding region						[2]
Strains Name			hCoV-19/Not Specified Virus Strain
RNA Binding Region			ORF10
Virus Name			Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells			Huh7 cells (human liver cell line) Huh7 cells (human liver cell line)  (CVCL_0336 )
Cell Originated Tissue			Liver
Interaction Score			P-value < 0.05
Method Description			RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641 Sample Type: Blood Samples Details: Healthy Control: 24; COVID-19: 62 Platform: GPL24676 Illumina NovaSeq 6000   PNG Download   GEO Accession: GSE162835 Sample Type: Nasopharyngeal Swabs Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3 Platform: GPL24676 Illumina NovaSeq 6000   PNG Download   GEO Accession: GSE175779 Sample Type: Human Bronchial Epithelial Cells Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h) Platform: GPL18573 Illumina NextSeq 500   PNG Download

Protein Phosphorylation after Virus Infection
S16 [3]   PNG Download
S17 [4]   PNG Download
S17 [3]   PNG Download
S19 [3]   PNG Download
S64 [3]   PNG Download
S74 [3]   PNG Download
S79 [3]   PNG Download
S86 [3]   PNG Download

Protein Sequence Information
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD     Click to Show/Hide

References
1	Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
2	Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.
3	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
4	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.