Details of Host Protein

Host Protein General Information (ID: PT0138)
Protein Name	cidic nuclear phosphoprotein pp32 (pp32)	Gene Name	ANP32A
Host Species	Homo sapiens	Uniprot Entry Name	AN32A_HUMAN
Protein Families	ANP32 family
Subcellular Location	Nucleus Cytoplasm Endoplasmic reticulum
External Link
	NCBI Gene ID	8125
	Uniprot ID	P39687
	Ensembl ID	ENSG00000140350
	HGNC ID	HGNC:13233
Function in Host	Multifunctional protein that is involved in the regulation ofmany processes including tumor suppression, apoptosis, cell cycleprogression or transcription. Promotes apoptosis by favouring theactivation of caspase-9/CASP9 and allowing apoptosome formation. In addition, plays a role in the modulation ofhistone acetylation and transcription as part of the INHAT (inhibitorof histone acetyltransferases) complex. Inhibits the histone-acetyltranferase activity of EP300/CREBBP (CREB-binding protein) andEP300/CREBBP-associated factor by histone masking. Preferentially binds to unmodified histone H3 and sterically inhibitingits acetylation and phosphorylation leading to cell growth inhibition. Participates in other biochemical processes such asregulation of mRNA nuclear-to-cytoplasmic translocation and stabilityby its association with ELAVL1 (Hu-antigen R). Playsa role in E4F1-mediated transcriptional repression as well asinhibition of protein phosphatase 2A. [1-3] Click to Show/Hide
3D Structure	PDB ID: 2JE0 FASTA Download 2D PNG Download PDB File Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[4]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 4.99756E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S17 [5] PNG Download
S27 [5] PNG Download
T15 [5] PNG Download

Protein Sequence Information
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD Click to Show/Hide

References
1	PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1. Mol Cell. 2008 Apr 25;30(2):239-47.
2	Tumor suppressor pp32 represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity. Cell Death Differ. 2006 Sep;13(9):1485-94.
3	Regulation of histone acetylation and transcription by nuclear protein pp32, a subunit of the INHAT complex. J Biol Chem. 2002 Apr 19;277(16):14005-10.
4	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.
5	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.