Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzesfatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3', 5'-bisphosphate. Preferentiallyhydrolyzes unsaturated long-chain acyl-CoA substrates such as oleoyl-CoA/ (9Z) -octadecenoyl-CoA and arachidonoyl-CoA/ (5Z, 8Z, 11Z, 14Z) -eicosatetraenoyl-CoA in the endoplasmic reticulum (ER) lumen. This catalytic activity is requiredfor maintaining ER structure and for lipid droplets (LDs) biogenesis, which are lipid storage organelles involved in maintaining lipid andenergy homeostasis. Directly binds to diacylglycerol (DAGs) and triacylglycerol, which isalso important for LD biogenesis. May supportdirectional budding of nacent LDs from the ER into the cytosol byreducing DAG levels at sites of LD formation. Plays arole in the regulation of cell morphology and cytoskeletal organization.

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK