Details of Host Protein

KEGG: hsa01100 Pathway Download ×

KEGG: hsa01232 Pathway Download ×

KEGG: hsa01240 Pathway Download ×

KEGG: hsa00730 Pathway Download ×

KEGG: hsa00230 Pathway Download ×

Host Protein General Information (ID: PT0154)
Protein Name	Adenylate kinase 4 (AK 4)	Gene Name	AK4
Host Species	Homo sapiens	Uniprot Entry Name	KAD4_HUMAN
Protein Families	Adenylate kinase family
EC Number	2.7.4.1.; 2.7.4.6
Subcellular Location	Mitochondrion matrix
External Link
	NCBI Gene ID	205
	Uniprot ID	P27144
	Ensembl ID	ENSG00000162433
	HGNC ID	HGNC:363
Function in Host	Involved in maintaining the homeostasis of cellularnucleotides by catalyzing the interconversion of nucleoside phosphates. Efficiently phosphorylates AMP and dAMP using ATP as phosphate donor, but phosphorylates only AMP when using GTP as phosphate donor. Also displaysbroad nucleoside diphosphate kinase activity. Plays a role in controlling cellularATP levels by regulating phosphorylation and activation of the energysensor protein kinase AMPK. Plays aprotective role in the cellular response to oxidative stress. [1-5] Click to Show/Hide
Related KEGG Pathway
	Metabolic pathways	hsa01100		Pathway Map
	Nucleotide metabolism	hsa01232		Pathway Map
	Biosynthesis of cofactors	hsa01240		Pathway Map
	Thiamine metabolism	hsa00730		Pathway Map
	Purine metabolism	hsa00230		Pathway Map
3D Structure	PDB ID: 2AR7 FASTA Download 2D PNG Download PDB File Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[6]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 3.28137E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY Click to Show/Hide

References
1	Modulation of anti-cancer drug sensitivity through the regulation of mitochondrial activity by adenylate kinase 4. J Exp Clin Cancer Res. 2016 Mar 16;35:48.
2	A mitochondrial RNAi screen defines cellular bioenergetic determinants and identifies an adenylate kinase as a key regulator of ATP levels. Cell Rep. 2014 May 8;7(3):907-17.
3	The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase. Int J Biochem Cell Biol. 2013 May;45(5):925-31.
4	Evidence of an intact N-terminal translocation sequence of human mitochondrial adenylate kinase 4. Int J Biochem Cell Biol. 2010 Jan;42(1):62-9.
5	Crystal structure of human adenylate kinase 4 (L171P) suggests the role of hinge region in protein domain motion. Biochem Biophys Res Commun. 2009 Jan 30;379(1):92-7.
6	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.