Details of Host Protein

KEGG: hsa04625 Pathway Download ×

KEGG: hsa05163 Pathway Download ×

KEGG: hsa05167 Pathway Download ×

KEGG: hsa05170 Pathway Download ×

KEGG: hsa05133 Pathway Download ×

KEGG: hsa05152 Pathway Download ×

KEGG: hsa05031 Pathway Download ×

KEGG: hsa05034 Pathway Download ×

KEGG: hsa04014 Pathway Download ×

Host Protein General Information (ID: PT0242)
Protein Name	Calmodulin-like skin protein (CLSP)	Gene Name	CALML5
Host Species	Homo sapiens	Uniprot Entry Name	CALL5_HUMAN
External Link
	NCBI Gene ID	51806
	Uniprot ID	Q9NZT1
	Ensembl ID	ENSG00000178372
	HGNC ID	HGNC:18180
Function in Host	Binds calcium. May be involved in terminal differentiation ofkeratinocytes. Click to Show/Hide
Related KEGG Pathway
	C-type lectin receptor signaling pathway	hsa04625		Pathway Map
	Human cytomegalovirus infection	hsa05163		Pathway Map
	Kaposi sarcoma-associated herpesvirus infection	hsa05167		Pathway Map
	Human immunodeficiency virus 1 infection	hsa05170		Pathway Map
	Pertussis	hsa05133		Pathway Map
	Tuberculosis	hsa05152		Pathway Map
	Amphetamine addiction	hsa05031		Pathway Map
	Alcoholism	hsa05034		Pathway Map
	Ras signaling pathway	hsa04014		Pathway Map
3D Structure	PDB ID: 2B1U FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Pro-viral	[1]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein CALML5 in viral infection, CALML5 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of CALML5 leads to the decreased SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 3.16084E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE Click to Show/Hide

References
1	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
2	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.