Details of Host Protein

Host Protein General Information (ID: PT0312)
Protein Name	Cystatin-A (CSTA)	Gene Name	CSTA
Host Species	Homo sapiens	Uniprot Entry Name	CYTA_HUMAN
Protein Families	Cystatin family
Subcellular Location	Cytoplasm
External Link
	NCBI Gene ID	1475
	Uniprot ID	P01040
	Ensembl ID	ENSG00000121552
	HGNC ID	HGNC:2481
Function in Host	This is an intracellular thiol proteinase inhibitor. Has animportant role in desmosome-mediated cell-cell adhesion in the lowerlevels of the epidermis. [1] Click to Show/Hide
3D Structure	PDB ID: 1CYU FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[2]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein CSTA in viral infection, CSTA protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of CSTA increases SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

Network Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[3]
Strains Name	hCoV-19/IPBCAMS-YL01/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	3'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Unlikely to be direct binder
Infection Cells	Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 )
Cell Originated Tissue	Liver
Infection Time	30 h
Interaction Score	MIST = 0.795086266
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[4]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 9.83006E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Click to Show/Hide

References
1	Mutations in CSTA, encoding Cystatin A, underlie exfoliative ichthyosis and reveal a role for this protease inhibitor in cell-cell adhesion. Am J Hum Genet. 2011 Oct 7;89(4):564-71.
2	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
3	Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
4	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.