Host Protein General Information (ID: PT0366)
  Protein Name
Dynein light chain 1, cytoplasmic (DYNLL1)
  Gene Name
DYNLL1
  Host Species
Homo sapiens
  Uniprot Entry Name
DYL1_HUMAN
  Protein Families
Dynein light chain family
  Subcellular Location
Cytoplasm; cytoskeleton; microtubule organizing center
  External Link
NCBI Gene ID
8655
Uniprot ID
P63167
Ensembl ID
ENSG00000088986
HGNC ID
HGNC:15476
  Function in Host
Acts as one of several non-catalytic accessory components ofthe cytoplasmic dynein 1 complex that are thought to be involved inlinking dynein to cargos and to adapter proteins that regulate dyneinfunction. Cytoplasmic dynein 1 acts as a motor for the intracellularretrograde motility of vesicles and organelles along microtubules. Mayplay a role in changing or maintaining the spatial distribution ofcytoskeletal structures.
    Click to Show/Hide
  Related KEGG Pathway
Salmonella infection hsa05132            Pathway Map 
Vasopressin-regulated water reabsorption hsa04962            Pathway Map 
  3D Structure

 Full List of Virus RNA Interacting with This Protien
            RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [1]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
ORF10
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human Lung Cancer Cell)  (CVCL_0609 )
              Cell Originated Tissue Liver
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Sequence Information
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
    Click to Show/Hide

References
1 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.