Home
Search 
Browse 
Download
ManualDetails of Host Protein
| Host Protein General Information (ID: PT0420) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
Eukaryotic translation initiation factor 5A-1 (EIF5A)
|
Gene Name |
EIF5A
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
IF5A1_HUMAN
|
||||||
| Protein Families |
EIF-5A family
|
||||||||
| Subcellular Location |
Cytoplasm and Cytosol; Nucleus; Endoplasmic reticulum
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
mRNA-binding protein involved in translation elongation. Has an importantfunction at the level of mRNA turnover, probably acting downstream ofdecapping. Criticalfor the efficient synthesis of peptide bonds between consecutiveproline residues. Can resolve ribosomal stalling caused by consecutive prolines duringtranslation. Involved in actin dynamics and cell cycle progression, mRNA decay andprobably in a pathway involved in stress response and maintenance ofcell wall integrity. With syntenin SDCBP, functions as a regulator ofp53/TP53 and p53/TP53-dependent apoptosis. Regulatesalso TNF-alpha-mediated apoptosis. Mediates effectsof polyamines on neuronal process extension and survival. May play an important role in brain development andfunction, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cellleukemia virus type I (HTLV-1) Rex protein and of humanimmunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNAexport of retroviral transcripts.
[1-5]
Click to Show/Hide
|
||||||||
| 3D Structure |
|
||||||||
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[6] | |||||||
| Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7 cells (liver carcinoma cell) (CVCL_0336 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 24h | ||||||||
| Interaction Score | log2FC = 7.24938E+13 | ||||||||
| Method Description | RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
S75
[7] |
 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Click to Show/Hide
|
|---|