Details of Host Protein

 Host Protein General Information (ID: PT0421)
  Protein Name
Eukaryotic initiation factor 5A2 (EIF5A2)
  Gene Name
EIF5A2
  Host Species
Homo sapiens
  Uniprot Entry Name
IF5A2_HUMAN
  Protein Families
EIF-5A family
  Subcellular Location
Cytoplasm and Cytosol; Endoplasmic reticulum
  External Link
NCBI Gene ID
56648
Uniprot ID
Q9GZV4
Ensembl ID
ENSG00000163577
HGNC ID
HGNC:3301
  Function in Host
mRNA-binding protein involved in translation elongation. Hasan important function at the level of mRNA turnover, probably actingdownstream of decapping. Critical for the efficient synthesis ofpeptide bonds between consecutive proline residues. Can resolveribosomal stalling caused by consecutive prolines during translation. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response andmaintenance of cell wall integrity. Functions as a regulator ofapoptosis. Mediates effects of polyamines on neuronal process extensionand survival. May play an important role in brain development andfunction, and in skeletal muscle stem cell differentiation. [1]
    Click to Show/Hide
  3D Structure
AlphaFold ID: Q9GZV4 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/England/02/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human lung cancer cell)  (CVCL_0609 )
              Cell Originated Tissue Lung
              Infection Time 24 h
              Interaction Score P-adjust = 0.096
              Method Description UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
    Click to Show/Hide

References
1 Identification and characterization of eukaryotic initiation factor 5A-2. Eur J Biochem. 2003 Nov;270(21):4254-63.
2 Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.