Binds to the 60S ribosomal subunit and prevents itsassociation with the 40S ribosomal subunit to form the 80S initiationcomplex in the cytoplasm. Behaves as a stimulatory translationinitiation factor downstream insulin/growth factors. Is also involvedin ribosome biogenesis. Associates with pre-60S subunits in the nucleusand is involved in its nuclear export. Cytoplasmic release of TIF6 from60S subunits and nuclear relocalization is promoted by a RACK1 (RACK1) -dependent protein kinase C activity. In tissues responsive to insulin, controls fatty acidsynthesis and glycolysis by exerting translational control ofadipogenic transcription factors such as CEBPB, CEBPD and ATF4 thathave G/C rich or uORF in their 5'UTR. Required for ROS-dependentmegakaryocyte maturation and platelets formation, controls theexpression of mitochondrial respiratory chain genes involved inreactive oxygen species (ROS) synthesis. Involved inmiRNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression andmiRNA-mediated cleavage of complementary mRNAs by RISC. Modulates cell cycle progression and globaltranslation of pre-B cells, its activation seems to be rate-limiting intumorigenesis and tumor growth. [1-4]

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT