Details of Host Protein

KEGG: hsa04975 Pathway Download ×

KEGG: hsa04936 Pathway Download ×

KEGG: hsa03320 Pathway Download ×

Host Protein General Information (ID: PT0443)
Protein Name	Fatty acid-binding protein 1 (FABP1)	Gene Name	FABP1
Host Species	Homo sapiens	Uniprot Entry Name	FABPL_HUMAN
Protein Families	Calycin superfamily
Subcellular Location	Cytoplasm
External Link
	NCBI Gene ID	2168
	Uniprot ID	P07148
	Ensembl ID	ENSG00000163586
	HGNC ID	HGNC:3555
Function in Host	Plays a role in lipoprotein-mediated cholesterol uptake inhepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, andsome other small molecules in the cytoplasm. May be involved inintracellular lipid transport. [1] Click to Show/Hide
Related KEGG Pathway
	Fat digestion and absorption	hsa04975		Pathway Map
	Alcoholic liver disease	hsa04936		Pathway Map
	PPAR signaling pathway	hsa03320		Pathway Map
3D Structure	PDB ID: 2F73 FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[2]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein FABP1 in viral infection, FABP1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of FABP1 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[3]
Strains Name	hCoV-19/USA/WA1/2020
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 )
Cell Originated Tissue	Liver
Infection Time	48 h
Interaction Score	FDR ≤ 0.05
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

Potential Drug(s) that Targets This Protein
Drug Name																									DrunkBank ID																				Pubchem ID																				TTD ID																									REF
Oleic acid																									DB04224																				445639																				D0A4EA																									[3]

Protein Sequence Information
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Click to Show/Hide

References
1	Human FABP1 T94A variant enhances cholesterol uptake. Biochim Biophys Acta. 2015 Jul;1851(7):946-55.
2	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
3	Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.