Details of Host Protein

KEGG: hsa03008 Pathway Download ×

Host Protein General Information (ID: PT0497)
Protein Name	snoRNP protein GAR1 (GAR1)	Gene Name	GAR1
Host Species	Homo sapiens	Uniprot Entry Name	GAR1_HUMAN
Protein Families	GAR1 family
Subcellular Location	Nucleus; nucleolus
External Link
	NCBI Gene ID	54433
	Uniprot ID	Q9NY12
	Ensembl ID	ENSG00000109534
	HGNC ID	HGNC:14264
Function in Host	Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves theisomerization of uridine such that the ribose is subsequently attachedto C5, instead of the normal N1. Each rRNA can contain up to 100pseudouridine ('psi') residues, which may serve to stabilize theconformation of rRNAs. May also be required for correct processing orintranuclear trafficking of TERC, the RNA component of the telomerasereverse transcriptase (TERT) holoenzyme. [1-2] Click to Show/Hide
Related KEGG Pathway
Related KEGG Pathway	Ribosome biogenesis in eukaryotes	hsa03008		Pathway Map
3D Structure	PDB ID: 7BGB FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[3]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein GAR1 in viral infection, GAR1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of GAR1 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[4]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.052
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH Click to Show/Hide

References
1	Architecture and assembly of mammalian H/ACA small nucleolar and telomerase ribonucleoproteins. EMBO J. 2004 Apr 21;23(8):1857-67.
2	In vitro assembly of human H/ACA small nucleolar RNPs reveals unique features of U17 and telomerase RNAs. Mol Cell Biol. 2000 May;20(9):3037-48.
3	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
4	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.