Host Protein General Information (ID: PT0542)
  Protein Name
Histone acetyltransferase type B catalytic subunit (HAT1)
  Gene Name
HAT1
  Host Species
Homo sapiens
  Uniprot Entry Name
HAT1_HUMAN
  Protein Families
HAT1 family
  EC Number
2.3.1.48
  Subcellular Location
Nucleus matrix Mitochondrion
  External Link
NCBI Gene ID
8520
Uniprot ID
O14929
Ensembl ID
ENSG00000128708
HGNC ID
HGNC:4821
  Function in Host
Histone acetyltransferase that plays a role in differentbiological processes including cell cycle progression, glucosemetabolism, histone production or DNA damage repair. Coordinates histoneproduction and acetylation via H4 promoter binding. Acetylates histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, histone H2A at 'Lys-5' (H2AK5ac). Drives H4 production by chromatin binding to supportchromatin replication and acetylation. Since transcription of H4 genesis tightly coupled to S-phase, plays an important role in S-phase entryand progression. Promotes homologous recombination inDNA repair by facilitating histone turnover and incorporation ofacetylated H3. 3 at sites of double-strand breaks. Inaddition, acetylates other substrates such as chromatin-relatedproteins. Acetylates also RSAD2 which mediates theinteraction of ubiquitin ligase UBE4A with RSAD2 leading to RSAD2ubiquitination and subsequent degradation. [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Neutrophil extracellular trap formation hsa04613            Pathway Map 
Alcoholism hsa05034            Pathway Map 
  3D Structure

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [4]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Phosphorylation after Virus Infection
S361 [5]
Picture Not Found
S361 [6]
Picture Not Found

Protein Sequence Information
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
    Click to Show/Hide

References
1 HAT1 Coordinates Histone Production and Acetylation via H4 Promoter Binding. Mol Cell. 2019 Aug 22;75(4):711-724.e5.
2 Structural basis for substrate specificity and catalysis of human histone acetyltransferase 1. Proc Natl Acad Sci USA. 2012 Jun 5;109(23):8925-30.
3 Effects of acetylation of histone H4 at lysines 8 and 16 on activity of the Hat1 histone acetyltransferase. J Biol Chem. 2001 Nov 23;276(47):43499-502.
4 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
5 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
6 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.