Component of the SIN3-repressing complex. Enhances theability of SIN3-HDAC1-mediated transcriptional repression. Whentethered to the promoter, it can direct the formation of a repressivecomplex to core histone proteins. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splicejunction on mRNAs. The EJC is a dynamic structure consisting of coreproteins and several peripheral nuclear and cytoplasmic associatedfactors that join the complex only transiently either during EJCassembly or during subsequent mRNA metabolism. Component of the ASAPand PSAP complexes which bind RNA in a sequence-independent manner andare proposed to be recruited to the EJC prior to or during the splicingprocess and to regulate specific excision of introns in specifictranscription subsets. The ASAP complex can inhibit mRNA processingduring in vitro splicing reactions. The ASAP complex promotes apoptosisand is disassembled after induction of apoptosis. Involved in thesplicing modulation of BCL2L1/Bcl-X (and probably other apoptoticgenes); specifically inhibits the formation of proapoptotic isoformssuch as Bcl-X (S); the activity is different from the established EJCassembly and function. [1-4]

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY