Details of Host Protein

Host Protein General Information (ID: PT0546)
Protein Name	Histone H1s-2 (H1.3)	Gene Name	H1-3
Host Species	Homo sapiens	Uniprot Entry Name	H13_HUMAN
Protein Families	Histone H1/H5 family
Subcellular Location	Nucleus
External Link
	NCBI Gene ID	3007
	Uniprot ID	P16402
	Ensembl ID	ENSG00000224287
	HGNC ID	HGNC:4717
Function in Host	Histone H1 protein binds to linker DNA between nucleosomesforming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chainsinto higher-order structured fibers. Acts also as a regulator ofindividual gene transcription through chromatin remodeling, nucleosomespacing and DNA methylation. Click to Show/Hide
3D Structure	AlphaFold ID: P16402 2D PNG Download mmCIF File Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Pro-viral	[1]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein H1-3 in viral infection, H1-3 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of H1-3 leads to the decreased SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/Not Specified Virus Strain )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Not Specified Virus Strain
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7 cells (liver carcinoma cell) (CVCL_0336 )
Cell Originated Tissue	Liver
Infection Time	24h
Interaction Score	log2FC = 1.52717E+14
Method Description	RNA antisense purification and quantitative mass spectrometry (RAP-MS); Tandem mass tag (TMT) labelling; liquid chromatography tandem mass spectrometry (LC-MS/MS); Westernblot

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S37 [3] PNG Download
T10 [4] PNG Download
T147 [4] PNG Download
T18 [4] PNG Download
T180 [4] PNG Download
T4 [4] PNG Download

Protein Sequence Information
MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK Click to Show/Hide

References
1	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
2	The SARS-CoV-2 RNA-protein interactome in infected human cells. Nat Microbiol. 2021 Mar;6(3):339-353.
3	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
4	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.