Details of Host Protein
Host Protein General Information (ID: PT0551) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Histone H3.2 (H2BC18)
|
Gene Name |
H3C15
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
H32_HUMAN
|
||||||
Protein Families |
Histone H3 family
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Core component of nucleosome. Nucleosomes wrap and compactDNA into chromatin, limiting DNA accessibility to the cellularmachineries which require DNA as a template. Histones thereby play acentral role in transcription regulation, DNA repair, DNA replicationand chromosomal stability. DNA accessibility is regulated via a complexset of post-translational modifications of histones, also calledhistone code, and nucleosome remodeling.
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Systemic lupus erythematosus | hsa05322 |
Pathway Map ![]() |
|||||||
Neutrophil extracellular trap formation | hsa04613 |
Pathway Map ![]() |
|||||||
Shigellosis | hsa05131 |
Pathway Map ![]() |
|||||||
Alcoholism | hsa05034 |
Pathway Map ![]() |
|||||||
Transcriptional misregulation in cancer | hsa05202 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[1] | |||||||
Strains Name |
hCoV-19/England/02/2020
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
Not Specified Virus Region
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Calu-3 cells (Human lung cancer cell) (CVCL_0609 ) | ||||||||
Cell Originated Tissue | Lung | ||||||||
Infection Time | 24 h | ||||||||
Interaction Score | P-adjust = 0.084 | ||||||||
Method Description | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
S29
[2] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
S58
[3] |
![]() |
Protein Sequence Information | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Click to Show/Hide
|