Details of Host Protein
Host Protein General Information (ID: PT0573) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Integrin-linked protein kinase 1 (ILK)
|
Gene Name |
ILK
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
ILK_HUMAN
|
||||||
Protein Families |
Protein kinase superfamily
|
||||||||
EC Number |
2.7.11.1
|
||||||||
Subcellular Location |
Cell junction; focal adhesion Cell membrane
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Receptor-proximal protein kinase regulating integrin-mediatedsignal transduction. May act as amediator of inside-out integrin signaling. Focaladhesion protein part of the complex ILK-PINCH. Thiscomplex is considered to be one of the convergence points ofintegrin- and growth factor-signaling pathway. Couldbe implicated in mediating cell architecture, adhesion to integrinsubstrates and anchorage-dependent growth in epithelial cells. Regulates cell motility by forming a complex withPARVB. Phosphorylates beta-1 and beta-3 integrinsubunit on serine and threonine residues, but also AKT1 and GSK3B.
[1]
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Bacterial invasion of epithelial cells | hsa05100 |
Pathway Map ![]() |
|||||||
Shigellosis | hsa05131 |
Pathway Map ![]() |
|||||||
Focal adhesion | hsa04510 |
Pathway Map ![]() |
|||||||
Endometrial cancer | hsa05213 |
Pathway Map ![]() |
|||||||
Axon guidance | hsa04360 |
Pathway Map ![]() |
|||||||
PPAR signaling pathway | hsa03320 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: 5'-UTR (hCoV-19/Wuhan-Hu-1/2019 ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[2] | |||||||
Strains Name |
hCoV-19/Wuhan-Hu-1/2019
|
||||||||
Strains Family |
Beta (B.1.351)
|
||||||||
RNA Binding Region |
5'-UTR
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | HEK293 Cells (Human embryonic kidney cell) (CVCL_0045 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Infection Time | 48 h | ||||||||
Interaction Score | Prot score = 26 | ||||||||
Method Description | RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
S186
[3] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
T181
[4] |
![]() |
Protein Sequence Information |
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Click to Show/Hide
|
---|