Details of Host Protein

KEGG: hsa05100 Pathway Download ×

KEGG: hsa05131 Pathway Download ×

KEGG: hsa04510 Pathway Download ×

KEGG: hsa05213 Pathway Download ×

KEGG: hsa04360 Pathway Download ×

KEGG: hsa03320 Pathway Download ×

Host Protein General Information (ID: PT0573)
Protein Name	Integrin-linked protein kinase 1 (ILK)	Gene Name	ILK
Host Species	Homo sapiens	Uniprot Entry Name	ILK_HUMAN
Protein Families	Protein kinase superfamily
EC Number	2.7.11.1
Subcellular Location	Cell junction; focal adhesion Cell membrane
External Link
	NCBI Gene ID	3611
	Uniprot ID	Q13418
	Ensembl ID	ENSG00000166333
	HGNC ID	HGNC:6040
Function in Host	Receptor-proximal protein kinase regulating integrin-mediatedsignal transduction. May act as amediator of inside-out integrin signaling. Focaladhesion protein part of the complex ILK-PINCH. Thiscomplex is considered to be one of the convergence points ofintegrin- and growth factor-signaling pathway. Couldbe implicated in mediating cell architecture, adhesion to integrinsubstrates and anchorage-dependent growth in epithelial cells. Regulates cell motility by forming a complex withPARVB. Phosphorylates beta-1 and beta-3 integrinsubunit on serine and threonine residues, but also AKT1 and GSK3B. [1] Click to Show/Hide
Related KEGG Pathway
	Bacterial invasion of epithelial cells	hsa05100		Pathway Map
	Shigellosis	hsa05131		Pathway Map
	Focal adhesion	hsa04510		Pathway Map
	Endometrial cancer	hsa05213		Pathway Map
	Axon guidance	hsa04360		Pathway Map
	PPAR signaling pathway	hsa03320		Pathway Map
3D Structure	PDB ID: 2KBX FASTA Download 2D PNG Download PDB File Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 5'-UTR (hCoV-19/Wuhan-Hu-1/2019 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[2]
Strains Name	hCoV-19/Wuhan-Hu-1/2019
Strains Family	Beta (B.1.351)
RNA Binding Region	5'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	HEK293 Cells (Human embryonic kidney cell) (CVCL_0045 )
Cell Originated Tissue	Liver
Infection Time	48 h
Interaction Score	Prot score = 26
Method Description	RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S186 [3] PNG Download
T181 [4] PNG Download

Protein Sequence Information
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK Click to Show/Hide

References
1	Cell-substrate interactions and signaling through ILK. Curr Opin Cell Biol. 2000 Apr;12(2):250-6.
2	RNA-Protein Interaction Analysis of SARS-CoV-2 5 and 3 Untranslated Regions Reveals a Role of Lysosome-Associated Membrane Protein-2a during Viral Infection. mSystems. 2021 Aug 31;6(4):e0064321.
3	Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
4	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.