Details of Host Protein

 Host Protein General Information (ID: PT0624)
  Protein Name
MaFF-interacting protein (DDX52)
  Gene Name
MAFIP
  Host Species
Homo sapiens
  Uniprot Entry Name
MAFIP_HUMAN
  Protein Families
Tektin family
  Subcellular Location
Cytoplasm Nucleus; nucleolus
  External Link
Uniprot ID
Q8WZ33
Ensembl ID
ENSG00000278053
HGNC ID
HGNC:31102
  Function in Host
Acts as coactivator of MAFF transcriptional activity. Inhibits cell growth and colony-forming efficiency. [1-2]
    Click to Show/Hide
  3D Structure
AlphaFold ID: Q8WZ33 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/Wuhan-Hu-1/2019 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [3]
              Strains Name
hCoV-19/Wuhan-Hu-1/2019
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells HEK293 Cells (Human embryonic kidney cell)  (CVCL_0045 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score Prot score = 16
              Method Description RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEELYKSITALREKLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQLAGYQ
    Click to Show/Hide

References
1 The novel human gene MIP functions as a co-activator of hMafF. Arch Biochem Biophys. 2006 May 15;449(1-2):87-93.
2 P5644 interacts with phosphatidylinositol-4-phosphate adaptor protein-1 associated protein-1. Mol Cell Biochem. 2005 Mar;271(1-2):151-8.
3 RNA-Protein Interaction Analysis of SARS-CoV-2 5 and 3 Untranslated Regions Reveals a Role of Lysosome-Associated Membrane Protein-2a during Viral Infection. mSystems. 2021 Aug 31;6(4):e0064321.