Details of Host Protein

Host Protein General Information (ID: PT0641)
Protein Name	APC-binding protein EB1 (EB1)	Gene Name	MAPRE1
Host Species	Homo sapiens	Uniprot Entry Name	MARE1_HUMAN
Protein Families	MAPRE family
Subcellular Location	Cytoplasm; cytoskeleton Cytoplasm; cytoskeleton
External Link
	NCBI Gene ID	22919
	Uniprot ID	Q15691
	Ensembl ID	ENSG00000101367
	HGNC ID	HGNC:6890
Function in Host	Plus-end tracking protein (+TIP) that binds to the plus-endof microtubules and regulates the dynamics of the microtubulecytoskeleton. Promotes cytoplasmic microtubule nucleation andelongation. Involved in mitoticspindle positioning by stabilizing microtubules and promoting dynamicconnection between astral microtubules and the cortex during mitoticchromosome segregation. Also acts asa regulator of minus-end microtubule organization: interacts with thecomplex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to theGolgi apparatus, thereby tethering non-centrosomal minus-endmicrotubules to the Golgi, an important step for polarized cellmovement. Promotes elongation of CAMSAP2-decoratedmicrotubule stretches on the minus-end of microtubules. Acts as a regulator of autophagosome transport viainteraction with CAMSAP2. May play a role in cellmigration. [1-8] Click to Show/Hide
3D Structure	PDB ID: 1PA7 FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[9]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein MAPRE1 in viral infection, MAPRE1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of MAPRE1 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[10]
Strains Name	hCoV-19/USA/WA1/2020
Strains Family	Alpha (B.1.1.7)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 )
Cell Originated Tissue	Liver
Infection Time	48 h
Interaction Score	FDR ≤ 0.05
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY Click to Show/Hide

References
1	Dynamic crotonylation of EB1 by TIP60 ensures accurate spindle positioning in mitosis. Nat Chem Biol. 2021 Dec;17(12):1314-1323.
2	EB1 and EB3 regulate microtubule minus end organization and Golgi morphology. J Cell Biol. 2017 Oct 2;216(10):3179-3198.
3	Noncentrosomal microtubules regulate autophagosome transport through CAMSAP2-EB1 cross-talk. FEBS Lett. 2017 Aug;591(16):2379-2393.
4	EB1 acetylation by P300/CBP-associated factor (PCAF) ensures accurate kinetochore-microtubule interactions in mitosis. Proc Natl Acad Sci USA. 2012 Oct 9;109(41):16564-9.
5	SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase. J Cell Biol. 2011 Jun 13;193(6):1083-99.
6	An EB1-binding motif acts as a microtubule tip localization signal. Cell. 2009 Jul 23;138(2):366-76.
7	Structural basis for the activation of microtubule assembly by the EB1 and p150Glued complex. Mol Cell. 2005 Aug 19;19(4):449-60.
8	Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome. Mol Biol Cell. 2002 Oct;13(10):3627-45.
9	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
10	Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.