Details of Host Protein

Host Protein General Information (ID: PT0656)
Protein Name	mRNA turnover protein 4 homolog (MRTO4)	Gene Name	MRTO4
Host Species	Homo sapiens	Uniprot Entry Name	MRT4_HUMAN
Protein Families	Universal ribosomal protein uL1. family
Subcellular Location	Nucleus; nucleolus Cytoplasm
External Link
	NCBI Gene ID	51154
	Uniprot ID	Q9UKD2
	Ensembl ID	ENSG00000053372
	HGNC ID	HGNC:18477
Function in Host	Component of the ribosome assembly machinery. Nuclear paralogof the ribosomal protein P0, it binds pre-60S subunits at an earlystage of assembly in the nucleolus, and is replaced by P0 incytoplasmic pre-60S subunits and mature 80S ribosomes. [1] Click to Show/Hide
3D Structure	AlphaFold ID: Q9UKD2 2D PNG Download mmCIF File Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[2]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein MRTO4 in viral infection, MRTO4 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of MRTO4 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[3]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.012
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Potential Drug(s) that Targets This Protein
Drug Name																									DrunkBank ID																				Pubchem ID																				TTD ID																									REF
SIROLIMUS																									DB00877																				5284616																				D03LJR																									[4]

Protein Sequence Information
MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD Click to Show/Hide

References
1	Subcellular localization of ribosomal P0-like protein MRT4 is determined by its N-terminal domain. Int J Biochem Cell Biol. 2010 May;42(5):736-48.
2	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
3	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.
4	Drug repurposing for coronavirus (SARS-CoV-2) based on gene co-expression network analysis. Sci Rep. 2021 Nov 8;11(1):21872.