Details of Host Protein

Host Protein General Information (ID: PT0660)
Protein Name	tRNA methyltransferase 112 homolog (TRMT112)	Gene Name	TRMT112
Host Species	Homo sapiens	Uniprot Entry Name	TR112_HUMAN
Protein Families	TRM112 family
Subcellular Location	Nucleus; nucleoplasm Cytoplasm; perinuclear region
External Link
	NCBI Gene ID	51504
	Uniprot ID	Q9UI30
	Ensembl ID	ENSG00000173113
	HGNC ID	HGNC:26940
Function in Host	Acts as an activator of both rRNA/tRNA and proteinmethyltransferases. Together with methyltransferase BUD23, methylates the N (7) position ofa guanine in 18S rRNA. The heterodimer withN6AMT1/HEMK2 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with N6AMT1/HEMK2also monomethylates 'Lys-12' of histone H4 (H4K12me1). The heterodimer with ALKBH8 catalyzes themethylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridineat the wobble position of the anticodon loop in target tRNA species. Together with methyltransferase THUMPD3, catalyzesthe formation of N (2) -methylguanosine at position 6 in a broad range oftRNA substrates and at position 7 of tRNA (Trp). Involved in the pre-rRNA processing steps leading to small-subunit rRNAproduction. Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of18S rRNA. [1-6] Click to Show/Hide
3D Structure	PDB ID: 6G4W FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Anti-viral	[7]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein TRMT112 in viral infection, TRMT112 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of TRMT112 increases SARS-CoV-2 RNA levels compared with control group.

Full List of Virus RNA Interacting with This Protien
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[8]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.026
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Phosphorylation after Virus Infection
S119 [9] PNG Download
S119 [9] PNG Download
S125 [9] PNG Download
S125 [9] PNG Download

Protein Sequence Information
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES Click to Show/Hide

References
1	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112. Nucleic Acids Res. 2019 Sep 5;47(15):7719-7733.
2	Structural insight into human N6amt1-Trm112 complex functioning as a protein methyltransferase. Cell Discov. 2019 Sep 10;5:51.
3	KMT9 monomethylates histone H4 lysine 12 and controls proliferation of prostate cancer cells. Nat Struct Mol Biol. 2019 May;26(5):361-371.
4	The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis. Mol Biol Cell. 2015 Jun 1;26(11):2080-95.
5	Human AlkB homolog ABH8 Is a tRNA methyltransferase required for wobble uridine modification and DNA damage survival. Mol Cell Biol. 2010 May;30(10):2449-59.
6	HemK2 protein, encoded on human chromosome 21, methylates translation termination factor eRF1. FEBS Lett. 2008 Jul 9;582(16):2352-6.
7	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
8	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.
9	The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.