Details of Host Protein

 Host Protein General Information (ID: PT0703)
  Protein Name
Nucleoside diphosphate kinase B (RBM12)
  Gene Name
NME2
  Host Species
Homo sapiens
  Uniprot Entry Name
NDKB_HUMAN
  Protein Families
NDK family
  EC Number
2.7.4.6; 2.7.13.3
  Subcellular Location
Cytoplasm Cell projection; lamellipodium Cell projection; ruffle
  External Link
NCBI Gene ID
4831
Uniprot ID
P22392
Ensembl ID
ENSG00000244462
HGNC ID
HGNC:7850
  Function in Host
Major role in the synthesis of nucleoside triphosphates otherthan ATP. The ATP gamma phosphate is transferred to the NDP betaphosphate via a ping-pong mechanism, using a phosphorylated active-siteintermediate. Negatively regulates Rho activity byinteracting with AKAP13/LBC. Acts as atranscriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-strandedguanine- and cytosine-rich strands within the nuclease hypersensitiveelement (NHE) III (1) region of the MYC gene promoter. Does not bind toduplex NHE III (1). Has G-quadruplex (G4) DNA-bindingactivity, which is independent of its nucleotide-binding and kinaseactivity. Binds both folded and unfolded G4 with similar low nanomolaraffinities. Stabilizes folded G4s regardless of whether they areprefolded or not. Exhibits histidine protein kinaseactivity. [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Metabolic pathways hsa01100            Pathway Map 
Nucleotide metabolism hsa01232            Pathway Map 
Biosynthesis of cofactors hsa01240            Pathway Map 
Purine metabolism hsa00230            Pathway Map 
Pyrimidine metabolism hsa00240            Pathway Map 
Drug metabolism - other enzymes hsa00983            Pathway Map 
  3D Structure
PDB ID: 1NSK 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [4]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S120 [5]
  PNG Download  
Picture Not Found
S122 [5]
  PNG Download  
Picture Not Found
T94 [6]
  PNG Download  
Picture Not Found

Protein Sequence Information
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
    Click to Show/Hide

References
1 The maize (Zea mays L.) nucleoside diphosphate kinase1 (ZmNDPK1) gene encodes a human NM23-H2 homologue that binds and stabilizes G-quadruplex DNA. Biochemistry. 2015 Mar 10;54(9):1743-57.
2 NM23-H2 may play an indirect role in transcriptional activation of c-myc gene expression but does not cleave the nuclease hypersensitive element III(1). Mol Cancer Ther. 2009 May;8(5):1363-77.
3 Human c-myc transcription factor PuF identified as nm23-H2 nucleoside diphosphate kinase, a candidate suppressor of tumor metastasis. Science. 1993 Jul 23;261(5120):478-80.
4 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
5 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
6 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.