Details of Host Protein

KEGG: hsa05146 Pathway Download ×

KEGG: hsa04146 Pathway Download ×

Host Protein General Information (ID: PT0725)
Protein Name	Peroxiredoxin-1 (PRDX1)	Gene Name	PRDX1
Host Species	Homo sapiens	Uniprot Entry Name	PRDX1_HUMAN
Protein Families	Peroxiredoxin family
EC Number	1.11.1.24
Subcellular Location	Cytoplasm Melanosome
External Link
	NCBI Gene ID	5052
	Uniprot ID	Q06830
	Ensembl ID	ENSG00000117450
	HGNC ID	HGNC:9352
Function in Host	Thiol-specific peroxidase that catalyzes the reduction ofhydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stressby detoxifying peroxides and as sensor of hydrogen peroxide-mediatedsignaling events. Might participate in the signaling cascades of growthfactors and tumor necrosis factor-alpha by regulating the intracellularconcentrations of H (2) O (2). Reduces an intramoleculardisulfide bond in GDPD5 that gates the ability to GDPD5 to drivepostmitotic motor neuron differentiation. [1] Click to Show/Hide
Related KEGG Pathway
	Amoebiasis	hsa05146		Pathway Map
	Peroxisome	hsa04146		Pathway Map
3D Structure	PDB ID: 2RII FASTA Download 2D PNG Download PDB File Download

Function of This Protein During Virus Infection
Virus Name	SARS-COV-2	Protein Function	Pro-viral	[2]
Infected Tissue	Lung	Infection Time	7-9 Days
Infected Cell	Calu-3 Cells (Human epithelial cell line)	Cellosaurus ID	CVCL_0609
Method Description	To detect the role of host protein PRDX1 in viral infection, PRDX1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
Results	It is reported that knockout of PRDX1 leads to the decreased SARS-CoV-2 RNA levels compared with control group.

Host Protein - Virus RNA Network

Network Download

Full List of Virus RNA Interacting with This Protien
*RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[3]
Strains Name	hCoV-19/IPBCAMS-YL01/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	3'-UTR
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Interaction Type	Potiential to be direct binder
Infection Cells	Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_E049 )
Cell Originated Tissue	Liver
Infection Time	30 h
Interaction Score	MIST = 0.90691074
Method Description	comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
*RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )*
RNA Region Details	RNA Info Click to show the detail information of this RNA binding region	[4]
Strains Name	hCoV-19/England/02/2020
Strains Family	Beta (B.1.351)
RNA Binding Region	Not Specified Virus Region
Virus Name	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Infection Cells	Calu-3 cells (Human lung cancer cell) Calu-3 cells (Human lung cancer cell) (CVCL_0609 )
Cell Originated Tissue	Lung
Infection Time	24 h
Interaction Score	P-adjust = 0.002
Method Description	UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection

GEO Accession: GSE152641

Sample Type: Blood

Samples Details: Healthy Control: 24; COVID-19: 62

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE162835

Sample Type: Nasopharyngeal Swabs

Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3

Platform: GPL24676 Illumina NovaSeq 6000

PNG Download

GEO Accession: GSE175779

Sample Type: Human Bronchial Epithelial Cells

Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)

Platform: GPL18573 Illumina NextSeq 500

PNG Download

Protein Sequence Information
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK Click to Show/Hide

References
1	Mammalian peroxiredoxin isoforms can reduce hydrogen peroxide generated in response to growth factors and tumor necrosis factor-alpha. J Biol Chem. 1998 Mar 13;273(11):6297-302.
2	Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
3	Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
4	Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.