Details of Host Protein

 Host Protein General Information (ID: PT0811)
  Protein Name
Proline-rich acidic protein 1 (PRAP1)
  Gene Name
PRAP1
  Host Species
Homo sapiens
  Uniprot Entry Name
PRAP1_HUMAN
  Subcellular Location
Secreted Endoplasmic reticulum
  External Link
NCBI Gene ID
118471
Uniprot ID
Q96NZ9
Ensembl ID
ENSG00000165828
HGNC ID
HGNC:23304
  Function in Host
Lipid-binding protein which promotes lipid absorption byfacilitating MTTP-mediated lipid transfer (mainly triglycerides andphospholipids) and MTTP-mediated apoB lipoprotein assembly andsecretion. Protects the gastrointestinal epitheliumfrom irradiation-induced apoptosis. May play animportant role in maintaining normal growth homeostasis in epithelialcells. Involved in p53/TP53-dependent cell survivalafter DNA damage. May down-regulate the expression ofMAD1L1 and exert a suppressive role in mitotic spindle assemblycheckpoint in hepatocellular carcinomas. [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Autophagy - animal hsa04140            Pathway Map 
  3D Structure
AlphaFold ID: Q96NZ9 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [4]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein PRAP1 in viral infection, PRAP1 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of PRAP1 increases SARS-CoV-2 RNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 5'-UTR (hCoV-19/Wuhan-Hu-1/2019 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [5]
              Strains Name
hCoV-19/Wuhan-Hu-1/2019
              Strains Family
Beta (B.1.351)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells HEK293 Cells (Human embryonic kidney cell)  (CVCL_0045 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score Prot score = 20
              Method Description RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

Protein Sequence Information
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
    Click to Show/Hide

References
1 Proline-rich acidic protein 1 (PRAP1) is a novel interacting partner of MAD1 and has a suppressive role in mitotic checkpoint signalling in hepatocellular carcinoma. J Pathol. 2014 May;233(1):51-60.
2 PRAP1 is a novel executor of p53-dependent mechanisms in cell survival after DNA damage. Cell Death Dis. 2012 Dec 13;3(12):e442.
3 The proline-rich acidic protein is epigenetically regulated and inhibits growth of cancer cell lines. Cancer Res. 2003 Oct 15;63(20):6658-65.
4 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
5 RNA-Protein Interaction Analysis of SARS-CoV-2 5 and 3 Untranslated Regions Reveals a Role of Lysosome-Associated Membrane Protein-2a during Viral Infection. mSystems. 2021 Aug 31;6(4):e0064321.