Home
Search 
Browse 
Download
ManualDetails of Host Protein
| Host Protein General Information (ID: PT0815) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
Proteasome activator complex subunit 3 (PSME3)
|
Gene Name |
PSME3
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
PSME3_HUMAN
|
||||||
| Protein Families |
PA28 family
|
||||||||
| Subcellular Location |
Nucleus Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associateswith the proteasome. 11S REG-gamma activates the trypsin-like catalyticsubunit of the proteasome but inhibits the chymotrypsin-like andpostglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53interaction which promotes ubiquitination- and MDM2-dependentproteasomal degradation of p53/TP53, limiting its accumulation andresulting in inhibited apoptosis after DNA damage. May also be involvedin cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1inhibition.
Click to Show/Hide
|
||||||||
| Related KEGG Pathway | |||||||||
| Antigen processing and presentation | hsa04612 |
Pathway Map 
|
|||||||
| Hepatitis C | hsa05160 |
Pathway Map 
|
|||||||
| Proteasome | hsa03050 |
Pathway Map 
|
|||||||
| 3D Structure |
|
||||||||
| Function of This Protein During Virus Infection | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Virus Name | SARS-COV-2 | Protein Function | Anti-viral | [1] | |||||
| Infected Tissue | Kidney | Infection Time | NA | ||||||
| Infected Cell | Vero e6 cells (African green monkey kidny cell) | Cellosaurus ID | CVCL_YZ66 | ||||||
| Method Description | To detect the role of host protein PSME3 in viral infection, PSME3 protein knockout Vero e6 cells were infected with SARS-COV-2 for several , and the effects on infection was detected through qRT-PCR. | ||||||||
| Results | It is reported that Knockout of PSME3 increases SARS-CoV-2 RNA levels compared with control group. | ||||||||
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[2] | |||||||
| Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 48 h | ||||||||
| Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
S24
[3] |
 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Click to Show/Hide
|
|---|