Details of Host Protein

 Host Protein General Information (ID: PT0819)
  Protein Name
Proteasome subunit alpha type-3 (PSMA3)
  Gene Name
PSMA3
  Host Species
Homo sapiens
  Uniprot Entry Name
PSA3_HUMAN
  Protein Families
Peptidase T1A family
  Subcellular Location
Cytoplasm Nucleus
  External Link
NCBI Gene ID
5684
Uniprot ID
P25788
Ensembl ID
ENSG00000100567
HGNC ID
HGNC:9532
  Function in Host
Component of the 20S core proteasome complex involved in theproteolytic degradation of most intracellular proteins. This complexplays numerous essential roles within the cell by associating withdifferent regulatory particles. Associated with two 19S regulatoryparticles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasomeplays a key role in the maintenance of protein homeostasis by removingmisfolded or damaged proteins that could impair cellular functions, andby removing proteins whose functions are no longer required. Associatedwith the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is requiredin several pathways including spermatogenesis (20S-PA200 complex) orgeneration of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and therebymediates its degradation. Negatively regulates the membrane traffickingof the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2. [1-5]
    Click to Show/Hide
  Related KEGG Pathway
Proteasome hsa03050            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Spinocerebellar ataxia hsa05017            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure
PDB ID: 4R3O 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [6]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S250 [7]
  PNG Download  
Picture Not Found
S250 [8]
  PNG Download  
Picture Not Found

Protein Sequence Information
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
    Click to Show/Hide

References
1 20S proteasome prevents aggregation of heat-denatured proteins without PA700 regulatory subcomplex like a molecular chaperone. Biomacromolecules. Jul-Aug 2004;5(4):1465-9.
2 Human 20S proteasome activity towards fluorogenic peptides of various chain lengths. Biol Chem. 2016 Sep 1;397(9):921-6.
3 Low expression of cell-surface thromboxane A2 receptor beta-isoform through the negative regulation of its membrane traffic by proteasomes. Prostaglandins Other Lipid Mediat. 2007 Jun;83(4):237-49.
4 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits. FEBS Lett. 2003 Oct 9;553(1-2):200-4.
5 A degradation signal located in the C-terminus of p21WAF1/CIP1 is a binding site for the C8 alpha-subunit of the 20S proteasome. EMBO J. 2001 May 15;20(10):2367-75.
6 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
7 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
8 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.