Host Protein General Information (ID: PT0825)
  Protein Name
Proteasome subunit beta type-3 (MAFIP)
  Gene Name
PSMB3
  Host Species
Homo sapiens
  Uniprot Entry Name
PSB3_HUMAN
  Protein Families
Peptidase T1B family
  Subcellular Location
Cytoplasm Nucleus
  External Link
NCBI Gene ID
5691
Uniprot ID
P49720
Ensembl ID
ENSG00000277400
HGNC ID
HGNC:9540
  Function in Host
Non-catalytic component of the 20S core proteasome complexinvolved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell byassociating with different regulatory particles. Associated with two19S regulatory particles, forms the 26S proteasome and thusparticipates in the ATP-dependent degradation of ubiquitinatedproteins. The 26S proteasome plays a key role in the maintenance ofprotein homeostasis by removing misfolded or damaged proteins thatcould impair cellular functions, and by removing proteins whosefunctions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways includingspermatogenesis (20S-PA200 complex) or generation of a subset of MHCclass I-presented antigenic peptides (20S-PA28 complex). [1-3]
    Click to Show/Hide
  Related KEGG Pathway
Proteasome hsa03050            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Spinocerebellar ataxia hsa05017            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [4]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein PSMB3 in viral infection, PSMB3 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of PSMB3 increases SARS-CoV-2 RNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [5]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

Protein Sequence Information
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
    Click to Show/Hide

References
1 20S proteasome prevents aggregation of heat-denatured proteins without PA700 regulatory subcomplex like a molecular chaperone. Biomacromolecules. Jul-Aug 2004;5(4):1465-9.
2 Human 20S proteasome activity towards fluorogenic peptides of various chain lengths. Biol Chem. 2016 Sep 1;397(9):921-6.
3 A role for the proteasome regulator PA28alpha in antigen presentation. Nature. 1996 May 9;381(6578):166-8.
4 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
5 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.