Details of Host Protein

 Host Protein General Information (ID: PT0855)
  Protein Name
Protein pelota homolog (PELO)
  Gene Name
PELO
  Host Species
Homo sapiens
  Uniprot Entry Name
PELO_HUMAN
  Protein Families
Eukaryotic release factor 1 family
  EC Number
3.1.-.-
  Subcellular Location
Nucleus Cytoplasm
  External Link
NCBI Gene ID
53918
Uniprot ID
Q9BRX2
Ensembl ID
ENSG00000152684
HGNC ID
HGNC:8829
  Function in Host
Cotranslational quality control factor involved in the No-GoDecay (NGD) pathway. In the presenceof ABCE1 and HBS1L, is required for 48S complex formation from 80Sribosomes and dissociation of vacant 80S ribosomes. Together with HBS1L and in presence of ABCE1, recognizes stalledribosomes and promotes dissociation of elongation complexes assembledon non-stop mRNAs; this triggers endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and to degrade damagedmRNAs as part of the No-Go Decay (NGD) pathway. Aspart of the PINK1-regulated signaling, upon mitochondrial damage isrecruited to the ribosome/mRNA-ribonucleoprotein complex associated tomitochondrial outer membrane thereby enabling the recruitment ofautophagy receptors and induction of mitophagy. [1-2]
    Click to Show/Hide
  Related KEGG Pathway
mRNA surveillance pathway hsa03015            Pathway Map 
  3D Structure
PDB ID: 1X52 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [3]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Sequence Information
MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
    Click to Show/Hide

References
1 Ubiquitination of ABCE1 by NOT4 in Response to Mitochondrial Damage Links Co-translational Quality Control to PINK1-Directed Mitophagy. Cell Metab. 2018 Jul 3;28(1):130-144.e7.
2 Dissociation by Pelota, Hbs1 and ABCE1 of mammalian vacant 80S ribosomes and stalled elongation complexes. EMBO J. 2011 May 4;30(9):1804-17.
3 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.