Details of Host Protein
| Host Protein General Information (ID: PT0909) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Protein Name |
Ras-related protein Rab-1B (RAB1B)
|
Gene Name |
RAB1B
|
||||||
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
RAB1B_HUMAN
|
||||||
| Protein Families |
Small GTPase superfamily
|
||||||||
| EC Number |
3.6.5.2
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Function in Host |
The small GTPases Rab are key regulators of intracellularmembrane trafficking, from the formation of transport vesicles to theirfusion with membranes. Rabs cyclebetween an inactive GDP-bound form and an active GTP-bound form that isable to recruit to membranes different set of downstream effectorsdirectly responsible for vesicle formation, movement, tethering andfusion. Plays a role in the initial events of theautophagic vacuole development which take place at specialized regionsof the endoplasmic reticulum. Regulates vesiculartransport between the endoplasmic reticulum and successive Golgicompartments. Required to modulate the compactedmorphology of the Golgi. Promotes the recruitment oflipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediatecompartment.
[1-2]
Click to Show/Hide
|
||||||||
| Related KEGG Pathway | |||||||||
| Legionellosis | hsa05134 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
| Function of This Protein During Virus Infection | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Virus Name | SARS-COV-2 | Protein Function | Anti-viral | [3] | |||||
| Infected Tissue | Lung | Infection Time | 7-9 Days | ||||||
| Infected Cell | Calu-3 Cells (Human epithelial cell line) | Cellosaurus ID | CVCL_0609 | ||||||
| Method Description | To detect the role of host protein RAB1B in viral infection, RAB1B protein Knockdown Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen. | ||||||||
| Results | It is reported that knockout of RAB1B increases SARS-CoV-2 RNA levels compared with control group. | ||||||||
| Full List of Virus RNA Interacting with This Protien | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 ) | |||||||||
| RNA Region Details |
RNA Info
Click to show the detail information of this RNA binding region
|
[4] | |||||||
| Strains Name |
hCoV-19/USA/WA1/2020
|
||||||||
| Strains Family |
Alpha (B.1.1.7)
|
||||||||
| RNA Binding Region |
Not Specified Virus Region
|
||||||||
| Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
| Infection Cells | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) (CVCL_7927 ) | ||||||||
| Cell Originated Tissue | Liver | ||||||||
| Infection Time | 48 h | ||||||||
| Interaction Score | FDR ≤ 0.05 | ||||||||
| Method Description | comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS) | ||||||||
| Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
T191
[5] |
![]() |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence Information |
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Click to Show/Hide
|
|---|





