Details of Host Protein
Host Protein General Information (ID: PT1036) | |||||||||
---|---|---|---|---|---|---|---|---|---|
Protein Name |
Bcl-XL-binding protein v68 (PRKDC)
|
Gene Name |
PGAM5
|
||||||
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PGAM5_HUMAN
|
||||||
Protein Families |
Phosphoglycerate mutase family
|
||||||||
EC Number |
3.1.3.16
|
||||||||
Subcellular Location |
Mitochondrion
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Function in Host |
Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently nophosphoglycerate mutase activity. May be regulator of mitochondrialdynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. Actsas a central mediator for programmed necrosis induced by TNF, byreactive oxygen species and by calcium ionophore.
[1-3]
Click to Show/Hide
|
||||||||
Related KEGG Pathway | |||||||||
Mitophagy - animal | hsa04137 |
Pathway Map ![]() |
|||||||
Necroptosis | hsa04217 |
Pathway Map ![]() |
|||||||
TNF signaling pathway | hsa04668 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Function of This Protein During Virus Infection | |||||||||
---|---|---|---|---|---|---|---|---|---|
Virus Name | SARS-COV-2 | Protein Function | Pro-viral | [4] | |||||
Infected Tissue | Lung | Infection Time | 7-9 Days | ||||||
Infected Cell | Calu-3 Cells (Human epithelial cell line) | Cellosaurus ID | CVCL_0609 | ||||||
Method Description | To detect the role of host protein PGAM5 in viral infection, PGAM5 protein knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen. | ||||||||
Results | It is reported that knockout of PGAM5 leads to the decreased SARS-CoV-2 RNA levels compared with control group. |
Full List of Virus RNA Interacting with This Protien | |||||||||
---|---|---|---|---|---|---|---|---|---|
RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain ) | |||||||||
RNA Region Details |
RNA Info
![]() |
[5] | |||||||
Strains Name |
hCoV-19/Not Specified Virus Strain
|
||||||||
RNA Binding Region |
ORF10
|
||||||||
Virus Name |
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
|
||||||||
Infection Cells | Huh7 cells (human liver cell line) (CVCL_0336 ) | ||||||||
Cell Originated Tissue | Liver | ||||||||
Interaction Score | P-value < 0.05 | ||||||||
Method Description | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) |
Differential Gene Expression During SARS-COV-2 Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Protein Phosphorylation after Virus Infection | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
S80
[6] |
![]() |
Protein Sequence Information |
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
Click to Show/Hide
|
---|