Details of Host Protein

 Host Protein General Information (ID: PT1065)
  Protein Name
Small ubiquitin-related modifier 1 (SUMO1)
  Gene Name
SUMO1
  Host Species
Homo sapiens
  Uniprot Entry Name
SUMO1_HUMAN
  Protein Families
Ubiquitin family
  Subcellular Location
Nucleus membrane; PML body Cell membrane Nucleus
  External Link
NCBI Gene ID
7341
Uniprot ID
P63165
Ensembl ID
ENSG00000116030
HGNC ID
HGNC:12502
  Function in Host
Ubiquitin-like protein that can be covalently attached toproteins as a monomer or a lysine-linked polymer. Covalent attachmentvia an isopeptide bond to its substrates requires prior activation bythe E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can bepromoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays acrucial role in a number of cellular processes such as nucleartransport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complexprotein RANBP2. Covalently attached to the voltage-gated potassiumchannel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO1 chains are also susceptible topolyubiquitination which functions as a signal for proteasomaldegradation of modified proteins. May also regulate a network of genesinvolved in palate development. Covalently attached to ZFHX3. [1-7]
    Click to Show/Hide
  Related KEGG Pathway
Nucleocytoplasmic transport hsa03013            Pathway Map 
Fluid shear stress and atherosclerosis hsa05418            Pathway Map 
  3D Structure
PDB ID: 1A5R 
FASTA   Download
  2D PNG Download  
PDB File Download

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/England/02/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [8]
              Strains Name
hCoV-19/England/02/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human lung cancer cell)  (CVCL_0609 )
              Cell Originated Tissue Lung
              Infection Time 24 h
              Interaction Score P-adjust = 0.007
              Method Description UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
T76 [9]
  PNG Download  
Picture Not Found

Protein Sequence Information
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
    Click to Show/Hide

References
1 Characterization of nuclear localization and SUMOylation of the ATBF1 transcription factor in epithelial cells. PLoS One. 2014 Mar 20;9(3):e92746.
2 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function. J Biol Chem. 2011 Dec 23;286(51):43793-43808.
3 SUMOylation regulates Kv2.1 and modulates pancreatic beta-cell excitability. J Cell Sci. 2009 Mar 15;122(Pt 6):775-9.
4 RNF4 is a poly-SUMO-specific E3 ubiquitin ligase required for arsenic-induced PML degradation. Nat Cell Biol. 2008 May;10(5):538-46.
5 Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25. Mol Cell. 2008 Jun 6;30(5):610-9.
6 Preferential modification of nuclear proteins by a novel ubiquitin-like molecule. J Biol Chem. 1997 May 30;272(22):14001-4.
7 A small ubiquitin-related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2. Cell. 1997 Jan 10;88(1):97-107.
8 Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Mol Cell. 2021 Jul 1;81(13):2851-2867.e7.
9 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.