Involved in several stages of intracellular trafficking. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns (3P) ) or phosphatidylinositol 3, 4-bisphosphate (PtdIns (3, 4) P2). Acts in part as component of the retromer membrane-deforming SNX-BAR subcomplex. The SNX-BAR retromer mediates retrogradetransport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport forcargo protein recycling. The SNX-BAR subcomplex functions to deform thedonor membrane into a tubular profile called endosome-to-TGN transportcarrier (ETC). Does not have in vitro vesicle-to-membraneremodeling activity. Involved in retrograde transportof lysosomal enzyme receptor IGF2R. May function as link between endosomal transport vesicles and dynactin. Plays a role in the internalization of EGFR after EGFstimulation. Involved in EGFR endosomal sorting anddegradation; the function involves PIP5K1C isoform 3 and is retromer-independent. Together with PIP5K1C isoform 3facilitates HGS interaction with ubiquitinated EGFR, which initiatesEGFR sorting to intraluminal vesicles (ILVs) of the multivesicular bodyfor subsequent lysosomal degradation. Involved in E-cadherinsorting and degradation; inhibits PIP5K1C isoform 3-mediated E-cadherindegradation. Plays a role in macropinocytosis. [1-4]

MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN