Host Protein General Information (ID: PT1098)
  Protein Name
STMN1 messenger RNA (STMN1)
  Gene Name
STMN1
  Host Species
Homo sapiens
  Uniprot Entry Name
STMN1_HUMAN
  Protein Families
Stathmin family
  Subcellular Location
Cytoplasm; cytoskeleton
  External Link
NCBI Gene ID
3925
Uniprot ID
P16949
Ensembl ID
ENSG00000117632
HGNC ID
HGNC:6510
  Function in Host
Involved in the regulation of the microtubule (MT) filamentsystem by destabilizing microtubules. Prevents assembly and promotesdisassembly of microtubules. Phosphorylation at Ser-16 may be requiredfor axon formation during neurogenesis. Involved in the control of thelearned and innate fear.
    Click to Show/Hide
  Related KEGG Pathway
MicroRNAs in cancer hsa05206            Pathway Map 
MAPK signaling pathway hsa04010            Pathway Map 
  3D Structure

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 5'-UTR (hCoV-19/Wuhan-Hu-1/2019 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [1]
              Strains Name
hCoV-19/Wuhan-Hu-1/2019
              Strains Family
Beta (B.1.351)
              RNA Binding Region
5'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells HEK293 Cells (Human embryonic kidney cell)  (CVCL_0045 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score Prot score = 49
              Method Description RNA-protein interaction detection (RaPID) assay; liquid chromatography with tandem mass spectrometry (LC-MS/MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Phosphorylation after Virus Infection
S16 [2]
Picture Not Found
S16 [3]
Picture Not Found
S25 [2]
Picture Not Found
S25 [3]
Picture Not Found
S38 [2]
Picture Not Found
S38 [3]
Picture Not Found
S63 [3]
Picture Not Found

Protein Sequence Information
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
    Click to Show/Hide

References
1 RNA-Protein Interaction Analysis of SARS-CoV-2 5 and 3 Untranslated Regions Reveals a Role of Lysosome-Associated Membrane Protein-2a during Viral Infection. mSystems. 2021 Aug 31;6(4):e0064321.
2 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
3 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.