Host Protein General Information (ID: PT1179)
  Protein Name
tRNA(m1A58)MTase subunit (TRMT61A)
  Gene Name
TRMT61A
  Host Species
Homo sapiens
  Uniprot Entry Name
TRM61_HUMAN
  Protein Families
Class I-like SAM-binding methyltransferase superfamily
  EC Number
2.1.1.22.; 2.1.1.-
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
115708
Uniprot ID
Q96FX7
Ensembl ID
ENSG00000166166
HGNC ID
HGNC:23790
  Function in Host
Catalytic subunit of tRNA (adenine-N (1) -) -methyltransferase, which catalyzes the formation of N (1) -methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. Catalyticsubunit of mRNA N (1) -methyltransferase complex, which mediatesmethylation of adenosine residues at the N (1) position of a smallsubset of mRNAs: N (1) methylation takes place in tRNA T-loop-likestructures of mRNAs and is only present at low stoichiometries. [1-3]
    Click to Show/Hide
  3D Structure

Function of This Protein During Virus Infection
Virus NameSARS-COV-2 Protein Function Anti-viral [4]
Infected TissueLung Infection Time7-9 Days
Infected CellCalu-3 Cells (Human epithelial cell line) Cellosaurus IDCVCL_0609 
Method DescriptionTo detect the role of host protein TRMT61A in viral infection, TRMT61A protein Knockout Calu-3 Cells were infected with SARS-COV-2 for 7 - 9 Days , and the effects on infection was detected through CRISPR-based genome-wide gene-knockout screen.
ResultsIt is reported that knockout of TRMT61A increases SARS-CoV-2 RNA levels compared with control group.

 Full List of Virus RNA Interacting with This Protien
            RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [5]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
ORF10
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human Lung Cancer Cell)  (CVCL_0609 )
              Cell Originated Tissue Liver
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
Picture Not Found

Protein Sequence Information
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
    Click to Show/Hide

References
1 The bipartite structure of the tRNA m1A58 methyltransferase from S cerevisiae is conserved in humans. RNA. 2005 Aug;11(8):1281-90.
2 The m1A landscape on cytosolic and mitochondrial mRNA at single-base resolution. Nature. 2017 Nov 9;551(7679):251-255.
3 Base-Resolution Mapping Reveals Distinct m 1 A Methylome in Nuclear- and Mitochondrial-Encoded Transcripts. Mol Cell. 2017 Dec 7;68(5):993-1005.e9.
4 Genome-wide CRISPR screens identify GATA6 as a proviral host factor for SARS-CoV-2 via modulation of ACE2. Nat Commun. 2022 Apr 25;13(1):2237.
5 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.