Details of Host Protein

 Host Protein General Information (ID: PT1189)
  Protein Name
Tubulin beta chain (MRPS18B)
  Gene Name
TUBB
  Host Species
Homo sapiens
  Uniprot Entry Name
TBB5_HUMAN
  Protein Families
Tubulin family
  Subcellular Location
Cytoplasm; cytoskeleton
  External Link
NCBI Gene ID
203068
Uniprot ID
P07437
Ensembl ID
ENSG00000226111
HGNC ID
HGNC:20778
  Function in Host
Tubulin is the major constituent of microtubules. It bindstwo moles of GTP, one at an exchangeable site on the beta chain and oneat a non-exchangeable site on the alpha chain.
    Click to Show/Hide
  Related KEGG Pathway
Pathogenic Escherichia coli infection hsa05130            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Phagosome hsa04145            Pathway Map 
Gap junction hsa04540            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Pathogenic Escherichia coli infection hsa05130            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Phagosome hsa04145            Pathway Map 
Gap junction hsa04540            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure
PDB ID: 3QNZ 
FASTA   Download
  2D PNG Download  
PDB File Download

Host Protein - Virus RNA Network
  Network Download  

 Full List of Virus RNA Interacting with This Protien
            RNA Region: 3'-UTR (hCoV-19/IPBCAMS-YL01/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [1], [2], [3]
              Strains Name
hCoV-19/IPBCAMS-YL01/2020
              Strains Family
Beta (B.1.351)
              RNA Binding Region
3'-UTR
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Interaction Type known to be direct binder
              Infection Cells Huh7.5.1 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_E049 )
              Cell Originated Tissue Liver
              Infection Time 30 h
              Interaction Score MIST = 0.840836801
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)
           RNA Region: ORF10 (hCoV-19/Not Specified Virus Strain )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [4]
              Strains Name
hCoV-19/Not Specified Virus Strain
              RNA Binding Region
ORF10
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Calu-3 cells (Human Lung Cancer Cell) Calu-3 cells (Human Lung Cancer Cell)  (CVCL_0609 )
              Cell Originated Tissue Liver
              Interaction Score P-value < 0.05
              Method Description RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
S172 [5]
  PNG Download  
Picture Not Found

Potential Drug(s) that Targets This Protein
Drug Name DrunkBank ID Pubchem ID TTD ID REF
CA4P DB05284  6918309  D09OKZ  [6]
Colchicine DB01394  6167  D09DHY  [7]
PACLITAXEL DB01229  36314  D0C4RB  [8]
PODOFILOX DB01179  10607  D0D4HN  [1]
Triflurin DB00831  5566  D0R4OM  [1]

Protein Sequence Information
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
    Click to Show/Hide

References
1 Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. Cell Res. 2022 Jan;32(1):9-23.
2 Viral and cellular proteins involved in coronavirus replication. Curr Top Microbiol Immunol. 2005;287:95-131.
3 Host cell proteins interacting with the 3 end of TGEV coronavirus genome influence virus replication. Virology. 2009 Sep 1;391(2):304-14.
4 Mapping the host protein interactome of non-coding regions in SARS-CoV-2 genome. bioRxiv. 2021 Jun; DOI:10.1101/2021.06.19.449092.
5 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.
6 The Global Phosphorylation Landscape of SARS-CoV-2 Infection. Cell. 2020 Aug 6;182(3):685-712.e19.
7 DrugBank
8 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.