Details of Host Protein

 Host Protein General Information (ID: PT1193)
  Protein Name
Tubulin-folding cofactor B (TBCB)
  Gene Name
TBCB
  Host Species
Homo sapiens
  Uniprot Entry Name
TBCB_HUMAN
  Protein Families
TBCB family
  Subcellular Location
Cytoplasm Cytoplasm; cytoskeleton
  External Link
NCBI Gene ID
1155
Uniprot ID
Q99426
Ensembl ID
ENSG00000105254
HGNC ID
HGNC:1989
  Function in Host
Binds to alpha-tubulin folding intermediates after theirinteraction with cytosolic chaperonin in the pathway leading from newlysynthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. Mayfunction as a negative regulator of axonal growth. [1]
    Click to Show/Hide
  3D Structure
AlphaFold ID: Q99426 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

 Full List of Virus RNA Interacting with This Protien
            RNA Region: Not Specified Virus Region (hCoV-19/USA/WA1/2020 )
              RNA Region Details RNA Info Click to show the detail information of this RNA binding region [2]
              Strains Name
hCoV-19/USA/WA1/2020
              Strains Family
Alpha (B.1.1.7)
              RNA Binding Region
Not Specified Virus Region
              Virus Name
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
              Infection Cells Huh7.5 cells (Hepatocyte derived cellular carcinoma cell)  (CVCL_7927 )
              Cell Originated Tissue Liver
              Infection Time 48 h
              Interaction Score FDR ≤ 0.05
              Method Description comprehensive identification of RNA-binding proteins by massspectrometry (ChIRP-MS)

Differential Gene Expression During SARS-COV-2 Infection
GEO Accession: GSE152641
Sample Type: Blood
Samples Details: Healthy Control: 24; COVID-19: 62
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE162835
Sample Type: Nasopharyngeal Swabs
Samples Details: COVID-19 (Mild Symptoms): 37; COVID-19 (Moderate Symptoms): 10; COVID-19 (Severe Symptoms): 3
Platform: GPL24676 Illumina NovaSeq 6000
  PNG Download  
Picture Not Found

GEO Accession: GSE175779
Sample Type: Human Bronchial Epithelial Cells
Samples Details: Healthy Control: 4 (0, 24, 48, 72 and 96 h); COVID-19: 4 (24, 48, 72 and 96 h)
Platform: GPL18573 Illumina NextSeq 500
  PNG Download  
Picture Not Found

Protein Phosphorylation after Virus Infection
T108 [3]
  PNG Download  
Picture Not Found

Protein Sequence Information
MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
    Click to Show/Hide

References
1 Tubulin subunits exist in an activated conformational state generated and maintained by protein cofactors. J Cell Biol. 1997 Aug 25;138(4):821-32.
2 Discovery and functional interrogation of SARS-CoV-2 RNA-host protein interactions. Cell. 2021 Apr 29;184(9):2394-2411.e16.
3 Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature. 2021 Jun;594(7862):246-252.